@prefix rdf: . @prefix : . @prefix mi: . @prefix obo: . @prefix owl: . @prefix xml: . @prefix xsd: . @prefix rdfs: . @prefix oboInOwl: . obo:IAO_0000115 a owl:AnnotationProperty ; rdfs:label "definition" . obo:IAO_0000231 a owl:AnnotationProperty . obo:IAO_0100001 a owl:AnnotationProperty . obo:MI_0000 obo:IAO_0000115 "Controlled vocabularies originally created for protein protein interactions, extended to other molecules interactions." ; oboInOwl:hasExactSynonym "mi" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0000" ; oboInOwl:inSubset mi:Drugable, mi:PSI-MI_slim ; a owl:Class ; rdfs:label "molecular interaction" . obo:MI_0001 obo:IAO_0000115 "Method to determine the interaction." ; oboInOwl:hasExactSynonym "interaction detect" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0001" ; oboInOwl:inSubset mi:Drugable, mi:PSI-MI_slim ; a owl:Class ; rdfs:label "interaction detection method" ; rdfs:subClassOf obo:MI_0000 . obo:MI_0002 obo:IAO_0000115 "Method to determine the molecules involved in the interaction." ; oboInOwl:hasExactSynonym "participant detection", "participant ident" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0002" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "participant identification method" ; rdfs:subClassOf obo:MI_0000 . obo:MI_0003 obo:IAO_0000115 "Method to determine the features of the proteins involved in the interaction." ; oboInOwl:hasExactSynonym "feature detection" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0003" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "feature detection method" ; rdfs:subClassOf obo:MI_0000 . obo:MI_0004 obo:IAO_0000115 "This class of approaches is characterised by the use of affinity resins as tools to purify molecule of interest (baits) and their binding partners. The baits can be captured by a variety of high affinity ligands linked to a resin - for example, antibodies specific for the bait itself, antibodies for specific tags engineered to be expressed as part of the bait or other high affinity binders such as glutathione resins for GST fusion proteins, metal resins for histidine-tagged proteins." ; oboInOwl:hasExactSynonym "Affinity purification", "affinity chrom" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0004" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "affinity chromatography technology" ; rdfs:subClassOf obo:MI_0091, obo:MI_0400 . obo:MI_0005 obo:IAO_0000115 "This approach is used to identify the residues that are involved in an interaction. Several variants of the native protein are prepared by sequentially mutating each residue of interest to an alanine. The mutated proteins are expressed and probed in the binding assay." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0005" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "alanine scanning" ; rdfs:subClassOf obo:MI_0810 . obo:MI_0006 obo:IAO_0000115 "A specific antibody for the molecule of interest (bait) is available, this is used to generate a high affinity resin to capture the endogenous bait present in a sample." ; oboInOwl:hasExactSynonym "anti bait coip" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0006" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "anti bait coimmunoprecipitation" ; rdfs:subClassOf obo:MI_0019 . obo:MI_0007 obo:IAO_0000115 "A specific antibody for the molecule of interest is not available, therefore the bait protein is expressed as a hybrid protein fused to a tag peptide/protein for which efficient and specific antibodies or a specific ligand are available." ; oboInOwl:hasExactSynonym "anti tag coip" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0007" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "anti tag coimmunoprecipitation" ; rdfs:subClassOf obo:MI_0019 . obo:MI_0008 obo:IAO_0000115 "In this class of methodologies, the molecules to be tested are presented ordered in an array format (typically at high density) on planar supports. The characteristics and chemical nature of the planar support can vary. This format permits the simultaneous assay, in controlled conditions, of several thousand proteins/peptides/nucleic acids for different functions, for instance their ability to bind any given molecule." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0008" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "array technology" ; rdfs:subClassOf obo:MI_0400 . obo:MI_0009 obo:IAO_0000115 "The protein of interest is presented on the outer membrane of Gram negative bacteria by expressing it as a fusion partner to peptide signals that direct heterologous proteins to the cell surface. For instance, a single chain Fv (scFv) antibody fragment, consisting of the variable heavy and variable light domains from two separate anti-digoxin monoclonal antibodies, was displayed on the outer membrane of Escherichia coli by fusing it to an Lpp-OmpA. Similar systems have also been developed for gram positive bacteria. Fluorescence-activated cell sorting (FACS), is used to specifically select clones displaying a protein binding to scFv-producing cells." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0009" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "bacterial display" ; rdfs:subClassOf obo:MI_0034, obo:MI_0054 . obo:MI_0010 obo:IAO_0000115 "Beta-galactosidase activity can be used to monitor the interaction of chimeric proteins. Pairs of inactive beta gal deletion mutants are capable of complementing to restore activity when fused to interacting protein partners. Critical to the success of this system is the choice of two poorly complementing mutant moieties, since strongly complementing mutants spontaneously assemble and produce functional beta-gal activity detectable in absence of any fused protein fragment." ; oboInOwl:hasExactSynonym "beta galactosidase" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0010" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "beta galactosidase complementation" ; rdfs:subClassOf obo:MI_0090 . obo:MI_0011 obo:IAO_0000115 "This strategy is based on a protein fragment complementation assay (PCA) of the enzyme TEM-1 beta-lactamase. The approach includes a simple colorimetric in vitro assays using the cephalosporin nitrocefin and assays in intact cells using the fluorescent substrate CCF2/AM. The combination of in vitro colorimetric and in vivo fluorescence assays of beta-lactamase in mammalian cells permits a variety of sensitive and high-throughput large-scale applications." ; oboInOwl:hasExactSynonym "beta lactamase" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0011" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "beta lactamase complementation" ; rdfs:subClassOf obo:MI_0090 . obo:MI_0012 obo:IAO_0000115 "In this variation of the FRET assay the donor fluorophore is replaced by a luciferase (typically Renilla luciferase). In the presence of its substrate, the luciferase catalyses a bioluminescent reaction that excites the acceptor fluorophore through a resonance energy transfer mechanism. As with FRET the energy transfer occurs only if the protein fused to the luciferase and the one fused to the acceptor fluorophore are in close proximity (10-100 Angstrom)." ; oboInOwl:hasExactSynonym "BRET", "LRET", "bret" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0012" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "bioluminescence resonance energy transfer" ; rdfs:subClassOf obo:MI_0051 . obo:MI_0013 obo:IAO_0000115 "The application of physical principles and methods to biological experiments." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0013" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "biophysical" ; rdfs:subClassOf obo:MI_0045 . obo:MI_0014 obo:IAO_0000115 "Adenylate cyclase is encoded by the cyaA gene and contains a catalytic domain which can be proteolytically cleaved into two complementary fragments, T25 and T18, which remain associated in the presence of calmodulin in a fully active ternary complex. In the absence of calmodulin, the mixture of the two fragments does not exhibit detectable activity, suggesting that the two fragments do not associate. When expressed in an adenylate cyclase-deficient E. coli strain (E. coli lacks calmodulin or calmodulin-related proteins), the T25 and T18 fragments fused to putative interacting proteins are brought into close association which result in cAMP synthesis. The level of reconstructed adenylate cyclase can be estimated by monitoring the expression of a cAMP dependent reporter gene. The T25 tagged protein is generally regarded as the bait, the T18 as the prey." ; oboInOwl:hasExactSynonym "adenylate cyclase", "bacterial two-hybrid" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0014" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "adenylate cyclase complementation" ; rdfs:subClassOf obo:MI_0090 . obo:MI_0016 obo:IAO_0000115 "Circular dichroism (CD) is observed when optically active molecules absorb left and right hand circularly polarized light slightly differently. Linearly polarized light can be viewed as a superposition of two components of circularly polarized light of equal amplitude and phase but opposite handness. When this light passes through an optically active sample the two polarized components are absorbed differently. The difference in left and right handed absorbance A(l)- A(r) is the signal registered in CD spectra. This signal displays distinct features corresponding to different secondary structures present in peptides, proteins and nucleic acids. The analysis of CD spectra can therefore yield valuable information about the secondary structure of biological macromolecules and the interactions among molecules that influence their structure." ; oboInOwl:hasExactSynonym "CD", "cd" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0016" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "circular dichroism" ; rdfs:subClassOf obo:MI_0013 . obo:MI_0017 obo:IAO_0000115 "Proteins contain endogenous fluorophores such as tryptophan residue and heme or flavins groups. Protein folding and protein-protein interaction can be studied by monitoring changes in the tryptophan environment detected by changes in its intrinsic fluorescence. Changes in the fluorescence emission spectrum on complex formation can occur either due to a shift in the wavelength of maximum fluorescence emission or by a shift in fluorescence intensity caused by the mixing of two proteins. The interaction of two proteins causes a shift in the fluorescence emission spectrum relative to the sum of the individual fluorescence spectra, resulting in a difference spectrum [F (complex)-2 F (sum)], which is a measurable effect of the interaction. Loss of fluorescence signal from a substrate can be used to measure protein cleavage." ; oboInOwl:hasExactSynonym "fluorescence spectr" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0017" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "classical fluorescence spectroscopy" ; rdfs:subClassOf obo:MI_0051 . obo:MI_0018 obo:IAO_0000115 "The classical two-hybrid system is a method that uses transcriptional activity as a measure of protein-protein interaction. It relies on the modular nature of many site-specific transcriptional activators (GAL 4) , which consist of a DNA-binding domain and a transcriptional activation domain. The DNA-binding domain serves to target the activator to the specific genes that will be expressed, and the activation domain contacts other proteins of the transcriptional machinery to enable transcription to occur. The two-hybrid system is based on the observation that the two domains of the activator need to be non-covalently brought together by the interaction of any two proteins. The application of this system requires the expression of two hybrid. Generally this assay is performed in yeast cell, but it can also be carried out in other organism. The bait protein is fused to the DNA binding molecule, the prey to the transcriptional activator." ; oboInOwl:hasExactSynonym "2 hybrid", "2-hybrid", "2H", "2h", "Gal4 transcription regeneration", "Y2H", "classical two hybrid", "two-hybrid", "yeast two hybrid" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:hasRelatedSynonym "Y-2H" ; oboInOwl:id "MI:0018" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "two hybrid" ; rdfs:subClassOf obo:MI_0232 . obo:MI_0019 obo:IAO_0000115 "In this approach an antibody, specific for the molecule of interest (bait) or any tag expressed within a fusion protein, is used to separate the bait from a molecular mixture or a cell lysate and to capture its ligand simultaneously. The partners that bind to the bait molecule retained by the resin can then be eluted and identified. The antibody may be free or bound to a matrix during this process." ; oboInOwl:hasExactSynonym "Co-IP", "CoIp", "co-immunoprecipitation", "coip", "immunoprecipitation" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0019" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "coimmunoprecipitation" ; rdfs:subClassOf obo:MI_0004 . obo:MI_0020 obo:IAO_0000115 "Microscopy technique in which a beam of electrons is transmitted through a sample to form an image. Samples can be purified molecules, for which no staining is required in order to detect interaction, or tissue/cells. In the latter case, during the treatment for microscope analysis a tissue section is incubated with high-specificity antibodies coupled to heavy metals (e.g. gold). Any tissue section can then be analysed by electron microscopy to localise the target proteins within the cell. This method supports very high resolution colocalisation of different molecules in a cell." ; oboInOwl:hasExactSynonym "tem" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0020" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "transmission electron microscopy" ; rdfs:subClassOf obo:MI_0040 . obo:MI_0021 obo:IAO_0000115 """Two proteins can be localised to cell compartments, in the same experiment, if they are expressed as chimeric proteins fused to distinct proteins fluorescing at different wavelengths (Green Fluorescent Protein and Red Fluorescent Protein for example). Using a confocal microscope the two proteins can be visualized in living cells and it can be determined whether they have the same subcellular location. Fluorescence microscopy of cells expressing a GFP fusion protein can also demonstrate dynamic processes such as its translocation from one subcellular compartment to another. OBSOLETE: use imaging technique (MI:0428) and specific probe as feature of each interacting protein.""" ; oboInOwl:hasExactSynonym "coloc fluoresc probe" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0021" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "colocalization by fluorescent probes cloning" ; owl:deprecated true . obo:MI_0022 obo:IAO_0000115 """The subcellular location of a protein can be demonstrated by treating cells fixed on a microscope slide with an antibody specific for the protein of interest. A secondary antibody conjugated with a reactive enzyme (e.g. horseradish peroxidase) is then added. Following a washing step to remove the unbound secondary ligand, a chromogenic substrate (e.g. 3,3', 5,5' tetramethyl benzidine chromogen [TMB]) is converted to a soluble coloured product by the conjugated enzyme and can then be visualised by standard microscopic techniques. OBSOLETE since combination of Interaction Detection Method and Interaction Type.Consider using the Interaction Detection Method imaging techniques (MI:0428) coupled with Interaction Type colocalisation (MI:0403) and Participant detection immunostaining (MI:0422) instead.""" ; oboInOwl:hasExactSynonym "Immunofluorescence Staining", "Immunostaining", "coloc immunostaining" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0022" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "colocalization by immunostaining" ; owl:deprecated true . obo:MI_0023 obo:IAO_0000115 """Techniques enabling the identification of the subcellular localisation of a protein or complex. Two different proteins show a similar distribution in the cell are said to co-localise. Obsolete since combination of Interaction Detection Method and Interaction Type. OBSOLETE. Consider using imaging techniques (MI:0428) as interaction detection method coupled with colocalisation (MI:0401) as interaction type and predetermined (MI:0396) as participant detection.""" ; oboInOwl:hasExactSynonym "coloc visual technol" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0023" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "colocalization/visualisation technologies" ; owl:deprecated true . obo:MI_0024 obo:IAO_0000115 "Text mining is used to support interactions which have been determined by other methods." ; oboInOwl:hasExactSynonym "conformational tm" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0024" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "confirmational text mining" ; rdfs:subClassOf obo:MI_0110 . obo:MI_0025 obo:IAO_0000115 """Approaches designed to separate cell components on the basis of their physicochemical properties. The observation that two or more proteins copurify in one or several conditions is taken as an indication that they form a molecular complex. OBSOLETE since too non-specific. Consider use of cosedimentation (MI:0027) or comigration in non denaturing gel electrophoresis (MI:0404) or affinity chromatography technologies (MI:0004) or molecular sieving (MI:0071) or for unspecific cases biochemical (MI:0401).""" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0025" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "copurification" ; owl:deprecated true . obo:MI_0026 obo:IAO_0000115 "Pairs of multiple alignments of orthologous sequences are used to identify potential interacting partners as proteins that show covariation of their residue identities between different species. Proteins displaying inter-protein correlated mutations during evolution are likely to be interacting proteins due to co-adapted evolution of their protein interacting interfaces." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0026" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "correlated mutations" ; rdfs:subClassOf obo:MI_0101, obo:MI_0660 . obo:MI_0027 obo:IAO_0000115 "Separation of a mixture of molecules under the influence of a force such as artificial gravity. Molecules sedimenting together are assumed to interact." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0027" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "cosedimentation" ; rdfs:subClassOf obo:MI_0401 . obo:MI_0028 obo:IAO_0000115 "The ultracentrifuge can be used to characterise and/or purify macromolecules in solution according to their mass and hydrodynamic properties. Sedimentation studies provide information about the molecular weight and shape of a molecule. It is also possible to measure the association state of the sample. Both the mass of a molecule and its shape, that influences the friction forces and diffusion that counterbalances gravity, determine the sedimentation speed." ; oboInOwl:hasExactSynonym "solution sedimentati" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0028" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "cosedimentation in solution" ; rdfs:subClassOf obo:MI_0027 . obo:MI_0029 obo:IAO_0000115 "Sedimentation through a density gradient measures the sedimentation rate of a mixture of proteins through either a glycerol or sucrose gradient. Two interacting proteins will sediment mostly as a complex at concentrations above the binding constant. By varying the concentration of one or both of the complex constituents and taking into account the dilution of the species during sedimentation, one can reasonably accurately estimate the binding constant." ; oboInOwl:hasExactSynonym "density sedimentation" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0029" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "cosedimentation through density gradient" ; rdfs:subClassOf obo:MI_0027 . obo:MI_0030 obo:IAO_0000115 "Analysis of complexes obtained by input of energy or chemical treatments, or by introducing cysteines followed by oxidation to promote the formation of covalent bonds among molecules in close proximity." ; oboInOwl:hasExactSynonym "crosslink" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0030" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "cross-linking study" ; rdfs:subClassOf obo:MI_0401 . obo:MI_0031 obo:IAO_0000115 "Cross-linking agents induce the formation of covalent bonds among proteins that are neighbours. The cross-linker may be a bifunctional molecule having two reactive ends linked by a spacer, often containing a disulfide bond. When a reducing agent is added the disulfide bridge is cleaved, the cross-linked pairs are released and can be identified. There are various classes of cross-linkers, the most common are those having photoreactive groups that become reactive fluorophores when activated by UV light thereby resulting in photolabeling the cross-linked moieties." ; oboInOwl:hasExactSynonym "Label transfer techniques", "Photoaffinity labelling", "bifunctional agent crosslink" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0031" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "protein cross-linking with a bifunctional reagent" ; rdfs:subClassOf obo:MI_0030 . obo:MI_0032 obo:IAO_0000115 "The strategy to determine the complete amino acid sequence of a protein by mass spectrometry relies on the generation of a nested set of fragments differing by one amino acid. This reveals the identity of the residue that has been removed at each degradation step by measuring the mass difference of fragments differing of one residue. Peptide fragments can be obtained by protease treatment combined with the fragmentation promoted by collision (or other methods) within a tandem mass spectrometer. This approach can be carried out with LC MS/MS (Liquid Chromatography Tandem Mass Spectrometry), nanoESI MS/MS (nanoElectrospray Ionisation tandem mass spectrometry), or FTMS (Fourier Transform mass spectrometry) instruments." ; oboInOwl:hasExactSynonym "de novo protein sequence" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:hasRelatedSynonym "MS/MS" ; oboInOwl:id "MI:0032" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "de novo protein sequencing by mass spectrometry" ; rdfs:subClassOf obo:MI_0093, obo:MI_0427, obo:MI_0659 . obo:MI_0033 obo:IAO_0000115 "In this approach, once a molecule is demonstrated to participate in an interaction, several deletion derivatives are produced and tested in the binding assay to identify the minimal fragment (domain) that can still support the interaction." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0033" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "deletion analysis" ; rdfs:subClassOf obo:MI_0074 . obo:MI_0034 obo:IAO_0000115 "All the methods that permit the physical linking of a protein/peptide to its coding sequence. As a consequence affinity purification of the displayed peptide results in the genetic enrichment of its coding sequence. By these technologies genes encoding a peptide with desired binding properties can be selected over an excess of up to 1012 unrelated molecules." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0034" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "display technology" ; rdfs:subClassOf obo:MI_0400 . obo:MI_0035 obo:IAO_0000115 "Predicts the structure of a molecular complex from the unbound structures of its components. The initial approach in the majority of docking procedures is based largely on the 'rigid-body' assumption, whereby the proteins are treated as solid objects. Initial scoring of a complex is based on geometric fit or surface complementarity. This generally requires some knowledge of the binding site to limit the number of solutions." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0035" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "docking" ; rdfs:subClassOf obo:MI_0105, obo:MI_0577 . obo:MI_0036 obo:IAO_0000115 "The rosetta stone, or domain fusion procedure, is based on the assumption that proteins whose homologues in other organisms happen to be fused into a single protein chain are likely to interact or to be functionally related." ; oboInOwl:hasExactSynonym "Rosetta Stone" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0036" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "domain fusion" ; rdfs:subClassOf obo:MI_0058, obo:MI_0101 . obo:MI_0037 obo:IAO_0000115 "This approach uses a protein interaction network of a given organism to infer interaction in another organism using information about the interacting region. The regions or domains involved in interactions are clustered if they share sequence similarity and have common interacting partners. The resulting domain profiles are then used to screen the proteome of another organism and domain-domain interactions are inferred. Ultimately, an inferred protein interaction map is built in this second organism." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0037" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "domain profile pairs" ; rdfs:subClassOf obo:MI_0046, obo:MI_0101, obo:MI_0660 . obo:MI_0038 obo:IAO_0000115 "In dynamic light scattering, particle diffusion in solution gives rise to fluctuations in the intensity of the scattered light on the microsecond scale. The hydrodynamic radius of the particles can be easily calculated." ; oboInOwl:hasExactSynonym "dls" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0038" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "dynamic light scattering" ; rdfs:subClassOf obo:MI_0067 . obo:MI_0039 obo:IAO_0000115 "In this procedure the N-terminus amino acid is cleaved from a polypeptide and identified by high-pressure liquid chromatography. The cycle is repeated on the ever-shortening polypeptide until all the residues are identified. On average only 20-30 consecutive cycles can be performed and lead to amino acid identification. Longer polypeptides or full length proteins must be cleaved by specific protease before Edman degradation and their sequences built by fragment overlapping." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0039" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "edman degradation" ; rdfs:subClassOf obo:MI_0433 . obo:MI_0040 obo:IAO_0000115 "Electron microscopy methods provide insights into the structure of biological macromolecules and their supramolecular assemblies. Resolution is on average around 10 Angstroms but can reach the atomic level when the samples analysed are 2D crystals. Different types of samples can be analysed by electron microscopy: crystals, single particles like viruses, macromolecular complexes or entire cells and tissue sections. Samples can be chemically fixed or vitrified by rapid freezing in liquid ethane, and then transferred into the electron microscope. Data collection consists of the recording of electron diffraction data (2D crystals) and images. Depending on the type of sample, different approaches are used to analyse and merge images and electron diffraction data." ; oboInOwl:hasExactSynonym "Electron cryomicroscopy", "Electron crystallography" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0040" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "electron microscopy" ; rdfs:subClassOf obo:MI_0428 . obo:MI_0041 obo:IAO_0000115 "A combination of NMR and EPR. The lines in the EPR spectrum that are caused by coupling of an unpaired electron nearby nuclei change in intensity when these nuclei are excited at their NMR frequency." ; oboInOwl:hasExactSynonym "ENDOR", "endor" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0041" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "electron nuclear double resonance" ; rdfs:subClassOf obo:MI_0043 . obo:MI_0042 obo:IAO_0000115 "EPR (also called ESR, Electron Spin Resonance) spectroscopy is analogous to NMR, but is based on the excitation of unpaired electrons instead of nuclei. Unpaired (single) electrons are only found in radicals and some metal ions (paramagnetic species); the EPR spectrum provides information about the environment and mobility of the paramagnetic species. The magnetic interaction of two paramagnetic centres in a protein can be used to calculate the distance between them; this allows studies of the movements and interactions of protein segments. In proteins without any intrinsic unpaired electrons it is possible to attach a radical probe (spin label). Stable nitroxide radicals can be bound to amino acid residues, in analogy with fluorescent probes. In combination with site directed mutagenesis this method is used in particular to study structure and assembly of membrane proteins, by measuring with EPR whether an amino acid is in a polar or non polar environment." ; oboInOwl:hasExactSynonym "EPR", "ESR", "epr" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0042" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "electron paramagnetic resonance" ; rdfs:subClassOf obo:MI_0043 . obo:MI_0043 obo:IAO_0000115 "A form of spectroscopy in which the absorption of microwave by a sample in a strong magnetic field is used to study atoms or molecules with unpaired electrons." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0043" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "electron resonance" ; rdfs:subClassOf obo:MI_0013, obo:MI_0659 . obo:MI_0045 obo:IAO_0000115 "Methods based on laboratory experiments to determine an interaction." ; oboInOwl:hasExactSynonym "experimental interac" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0045" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "experimental interaction detection" ; rdfs:subClassOf obo:MI_0001 . obo:MI_0046 obo:IAO_0000115 "Predictive algorithms that rely on the information obtained by experimental results." ; oboInOwl:hasExactSynonym "experimental info" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0046" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "experimental knowledge based" ; rdfs:subClassOf obo:MI_0063 . obo:MI_0047 obo:IAO_0000115 "Proteins are fractionated by PAGE (SDS-polyacrylamide gel electrophoresis), transferred to a nitrocellulose membrane and tested for the ability to bind to a protein, a peptide, or any other ligand. Cell lysates can also be fractionated before gel electrophoresis to increase the sensitivity of the method for detecting interactions with rare proteins. Denaturants are removed during the blotting procedure, which allows many proteins to recover (or partially recover) activity. However, if biological activity is not recoverable, the proteins can be fractionated by a non denaturing gel system. This variation of the method eliminates the problem of activity regeneration and allows the detection of binding when the presence of a protein complex is required for binding. The protein probe can be prepared by any one of several procedures, while fusion affinity tags greatly facilitate purification. Synthesis in E. coli with a GST fusion, epitope tag, or other affinity tag is most commonly used. The protein of interest can then be radioactively labelled, biotinylated, or used in the blotting procedure as an unlabeled probe that is detected by a specific antibody." ; oboInOwl:hasExactSynonym "Affinity blotting" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0047" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "far western blotting" ; rdfs:subClassOf obo:MI_0892 . obo:MI_0048 obo:IAO_0000115 "Filamentous phages (M13, f1, fd) have been extensively used to develop and implement the technology of phage display. Repertoires of relatively short peptides of random amino acid sequences or cDNA libraries have been constructed and searched successfully. Most experiments have taken advantage of the ability to assemble phages decorated with hybrid versions of the receptor protein pIII or of the major coat protein pVIII. Both systems allow the display of foreign peptides by fusion to the amino-terminus of the capsid protein but differ in the number of peptide copies that can be displayed on each phage particle. Display libraries of very diverse protein fragments have been constructed by fusing either genomic or cDNA fragments to gene III or gene VIII." ; oboInOwl:hasExactSynonym "filamentous phage" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0048" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "filamentous phage display" ; rdfs:subClassOf obo:MI_0084 . obo:MI_0049 obo:IAO_0000115 "A method in which separation depends upon the ability of one participant to bind to a filter or membrane which the other participants do not. Molecules interacting with the bound molecule will also be retain on the filter. For example, proteins expressed by different clones of an expression library are bound to a nitrocellulose membrane, by colony (bacterial library) or plaque (phage library) blotting. A labelled protein can then be used as a probe to identify clones expressing proteins that interact with the probe. Interactions occur on the nitrocellulose filters. The method is highly general and therefore widely applicable. A variety of approaches can be used to label the ligand, alternatively the ligand can be detected by a specific antibody." ; oboInOwl:hasExactSynonym "Filter overlay assay" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:hasRelatedSynonym "dot blot" ; oboInOwl:id "MI:0049" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "filter binding" ; rdfs:subClassOf obo:MI_0892 . obo:MI_0050 obo:IAO_0000115 """The protein of interest is expressed as a fusion to the peptide DYKDDDDKV for which antibodies are commercially available. Sometimes multiple copies of the peptide are fused in tandem. OBSOLETE redundant term. Map to feature type: flag-tagged (MI:0518) and Interaction detection method: anti tag coimmunoprecipitation (MI:0007).""" ; oboInOwl:hasExactSynonym "flag tag coip" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0050" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "flag tag coimmunoprecipitation" ; owl:deprecated true . obo:MI_0051 obo:IAO_0000115 "Techniques based upon the measurement of the emission of one or more photons by a molecule activated by the absorption of a quantum of electro-magnetic radiation. Typically the emission, which is characterised by a wavelength that is longer than the one of excitatory radiation, occurs within 10-8 seconds." ; oboInOwl:hasExactSynonym "fluorescence" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0051" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "fluorescence technology" ; rdfs:subClassOf obo:MI_0013 . obo:MI_0052 obo:IAO_0000115 "FCS monitors the random motion of fluorescently labelled molecules inside a defined volume irradiated by a focused laser beam. These fluctuations provide information on the rate of diffusion or diffusion time of a particle and this is directly dependent on the particle mass. As a consequence, any increase in the mass of a biomolecule, e.g. as a result of an interaction with a second molecule, is readily detected as an increase in the diffusion time of the particle. From these results the concentration of the different molecules can be calculated as well as their binding constant." ; oboInOwl:hasExactSynonym "FCS", "fcs" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:hasRelatedSynonym "fluctuation correlation specctrometry" ; oboInOwl:id "MI:0052" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "fluorescence correlation spectroscopy" ; rdfs:subClassOf obo:MI_0051 . obo:MI_0053 obo:IAO_0000115 "Because of the long lifetimes of excited fluorescent molecules (nanoseconds), fluorescence can be used to monitor the rotational motion of molecules, which occurs on this timescale. This is accomplished experimentally by excitation with plane-polarized light, followed by measurement of the emission at parallel and perpendicular planes. Since rotational correlation times depend on the size of the molecule, this method can be used to measure the binding of two proteins because the observed polarization increase when a larger complex is formed. A fluorescence anisotropy experiment is normally carried out with a protein bearing a covalently added fluorescent group, which increases both the observed fluorescence lifetime of the excited state and the intensity of the fluorescent signal. Residue modification can be assessed by addition of an antibody which binds to the modified residue and alters the molecular weight of the complex. A variation of this technique has been used to show interaction of a DNA binding protein with another protein. In this case the DNA rather than protein is fluorescently labelled." ; oboInOwl:hasExactSynonym "FPS", "Fluorescence anisotropy", "fps" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0053" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "fluorescence polarization spectroscopy" ; rdfs:subClassOf obo:MI_0051 . obo:MI_0054 obo:IAO_0000115 "Cells in suspension flow through a laser beam, the scattered light or emitted fluorescence is measured, filtered and converted to digital values. Cells can be sorted according to their properties. Using flow cytometry, any fluorescent or light scattering experiment can be carried out on entire cells. With this instrument, interactions occurring either on cell surfaces or in any other subcellular location can be studied by using suitable fluorescent labels." ; oboInOwl:hasExactSynonym "FACS", "Flow cytometry", "facs" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0054" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "fluorescence-activated cell sorting" ; rdfs:subClassOf obo:MI_0051 . obo:MI_0055 obo:IAO_0000115 "FRET is a quantum mechanical process involving the radiationless transfer of energy from a donor fluorophore to an appropriately positioned acceptor fluorophore. The fluorophores are genetically fused to the protein in analysis and cotransfected. Three basic conditions must be fulfilled for FRET to occur between a donor molecule and acceptor molecule. First, the donor emission spectrum must significantly overlap the absorption spectrum of the acceptor. Second, the distance between the donor and acceptor fluorophores must fall within the range 20 to 100 Angstrom. Third, the donor and acceptor fluorophores must be in favourable orientations." ; oboInOwl:hasExactSynonym "FRET", "FRET analysis", "RET", "fret" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0055" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "fluorescent resonance energy transfer" ; rdfs:subClassOf obo:MI_0051 . obo:MI_0056 obo:IAO_0000115 "Sequencing occurs during the course of the experiment. DNA sequencing is the process of determining the nucleotide order of a given DNA fragment. Thus far, most DNA sequencing has been performed using the chain termination method developed by Frederick Sanger. This technique uses sequence-specific termination of a DNA synthesis reaction using modified nucleotide substrates. However, new sequencing technologies such as Pyrosequencing are generating the majority of data." ; oboInOwl:hasExactSynonym "full dna sequence" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0056" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "full identification by DNA sequencing" ; rdfs:subClassOf obo:MI_0078, obo:MI_0659 . obo:MI_0057 obo:IAO_0000115 "Gene pairs that show a conserved topological neighbourhood in many prokaryotic genomes are considered by this approach to encode interacting or functionally related proteins. By measuring the physical distance of any given gene pair in different genomes, interacting partners are inferred." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0057" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "gene neighbourhood" ; rdfs:subClassOf obo:MI_0058 . obo:MI_0058 obo:IAO_0000115 "Methods that require fully sequenced genomes either because they are based on the comparison of genome topology or on the identification of orthologous sequences in different genomes." ; oboInOwl:hasExactSynonym "genome prediction" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0058" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "genome based prediction" ; rdfs:subClassOf obo:MI_0063 . obo:MI_0059 obo:IAO_0000115 """The bait protein is expressed and purified as a fusion to the glutathione S-tranferase protein. The bait protein is normally attached to a glutathione sepharose resin or alternatively to a support containing an anti-GST antibody. OBSOLETE redundant term. Map to feature type : gst-tagged (MI:0519) and Interaction detection method: pull down (MI:0096).""" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0059" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "gst pull down" ; owl:deprecated true . obo:MI_0060 obo:IAO_0000115 """The protein of interest is expressed as a fusion to the peptide YPYDVPDYA (a fragment of the influenza hemaglutinin protein) for which antibodies are commercially available. OBSOLETE redundant term. Map to feature type : ha-tagged (MI:0520) and Interaction detection method: anti tag coimmunoprecipitation (MI:0007).""" ; oboInOwl:hasExactSynonym "ha tag coip" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0060" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "ha tag coimmunoprecipitation" ; owl:deprecated true . obo:MI_0061 obo:IAO_0000115 """The bait protein is expressed and purified fused to an amino or carboxyterminal tail containing a variable number of histidines. The bait protein is normally attached to a metal (usually nickel) resin. OBSOLETE redundant term. Map to feature type : his-tagged (MI:0521) and Interaction detection method: pull down (MI:0096).""" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0061" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "his pull down" ; owl:deprecated true . obo:MI_0062 obo:IAO_0000115 """The protein of interest is expressed as a fusion to a poly-His tail. This permits purification by chromatography over a metal column or by binding to commercially available anti poly-His antibodies. OBSOLETE redundant term. Map to feature type: his-tagged (MI:0521) and Interaction detection method: anti tag coimmunoprecipitation (MI:0007).""" ; oboInOwl:hasExactSynonym "his tag coip" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0062" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "his tag coimmunoprecipitation" ; owl:deprecated true . obo:MI_0063 obo:IAO_0000115 "Computational methods to predict an interaction." ; oboInOwl:hasExactSynonym "in silico methods", "predicted interac" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0063" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "interaction prediction" ; rdfs:subClassOf obo:MI_0001 . obo:MI_0064 obo:IAO_0000115 "Protein interactions, experimentally detected in an organism, are extended to a second organism assuming that homologue proteins, in different organisms, maintain their interaction properties." ; oboInOwl:hasExactSynonym "Homology based interaction prediction" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0064" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "interologs mapping" ; rdfs:subClassOf obo:MI_0046, obo:MI_0101 . obo:MI_0065 obo:IAO_0000115 "Isothermal titration calorimetry (ITC) measures directly the energy associated with a chemical reaction triggered by the mixing of two components. A typical ITC experiment is carried out by the stepwise addition of one of the reactants (~10-6 L per injection) into the reaction cell (~1mL) containing the second reactant. The chemical reaction occurring after each injection either releases or absorbs heat (qi) proportional to the amount of ligand that binds to the protein with a characteristic binding enthalpy (DH). As modern ITC instruments operate on the heat compensation principle, the instrumental response (measured signal) is the amount of power (microcalories per second) necessary to maintain constant the temperature difference between the reaction and the reference cells. Because the amount of uncomplexed protein available progressively decreases after each successive injection, the magnitude of the peaks becomes progressively smaller until complete saturation is achieved. The difference between the concentration of bound ligand in the ith and (i-1)th injections depends on the binding constant Ka and the total ligand injected. The calculations depend on the binding model (number of substrates). Analysis of the data yields DH and DG = -RTlnKa. The entropy change is obtained by using the standard thermodynamic expression DG = DH-TDS." ; oboInOwl:hasExactSynonym "ITC", "itc" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0065" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "isothermal titration calorimetry" ; rdfs:subClassOf obo:MI_0013 . obo:MI_0066 obo:IAO_0000115 "Morphologically classified as one of the siphoviridae, lambda is a temperate bacteriophage of E.coli, with a double-stranded DNA genome. It has an icosahedral head attached to a flexible helical tail. Both the tail protein pV and the head protein pD have been used for displaying (C or N terminally) foreign peptides on the viral capsid." ; oboInOwl:hasExactSynonym "lambda phage" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0066" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "lambda phage display" ; rdfs:subClassOf obo:MI_0084 . obo:MI_0067 obo:IAO_0000115 "Dynamic and static laser light scattering probes the size, shape, and structure of biological macromolecules or of their assemblies. A beam is focused on an optically clear cylindrical cell containing the sample. Most of the light passes directly through the sample. A small portion of the light is scattered; the scattered light intensity containing information about the scattering particle is detected at an angle (typically in the range 15-180degrees) from the direction of the incident beam." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0067" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "light scattering" ; rdfs:subClassOf obo:MI_0013 . obo:MI_0068 obo:IAO_0000115 "Mass spectrometry can be used to characterise chemical modifications within peptides. One approach consists in the observation of a mass difference when a sample is treated with an enzyme that can specifically remove a peptide modification, for instance a phosphatase. The mass difference corresponds to the mass of the chemical group covalently linked to a residue. Such experiments carried out with a MALDI-TOF (Matrix-assisted laser desorption ionization time-of-flight ) do not allow the mapping of the modification site within the sequence, whereas any tandem mass spectrometer (LC MS/MS Liquid Chromatography Tandem Mass Spectrometry, nanoESI MS/MS nanoElectrospray Ionisation tandem mass spectrometry, FTMS Fourier Transform mass spectrometry) provide such information. A second approach consists of the direct mass measurement of the ionized chemical group dissociated from the residue within a tandem mass spectrometer. Both approaches need a prior enrichment of the modified peptide population in the samples with IMAC (Immobilized Metal Affinity Chromatography)or specific anti-modification antibodies." ; oboInOwl:hasExactSynonym "modified residue ms" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0068" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "mass detection of residue modification" ; rdfs:subClassOf obo:MI_0659 . obo:MI_0069 obo:IAO_0000115 "Mass spectrometric approaches to the study of macromolecular complexes permits the identification of subunit stoichiometry and transient associations. By preserving complexes intact in the mass spectrometer, mass measurement can be used for monitoring changes in different experimental conditions, or to investigate how variations of collision energy affect their dissociation." ; oboInOwl:hasExactSynonym "ms of complexes" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0069" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "mass spectrometry studies of complexes" ; rdfs:subClassOf obo:MI_0943 . obo:MI_0070 obo:IAO_0000115 "Protein modifications can be identified by gel electrophoresis since any change in the mass and/or the charge of the protein can alter its mobility in PAGE. Although this method does not allow the unequivocal identification of the type of modification that has caused the shift, it is possible, by combining this approach with more direct methods, to correlate the extent of the shift to a specific modification." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0070" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "mobility shift" ; rdfs:subClassOf obo:MI_0659 . obo:MI_0071 obo:IAO_0000115 "In sizing columns (gel filtration), the elution position of a protein or of a complex depends on its Stokes radius. Molecules with a radius that is smaller than the bead size are retained and retarded by the interaction with the matrix. The observation that two proteins, loaded on a sieving column, elute in a fraction(s) corresponding to a MW that is larger than the MW of either protein may be taken as an indication that the two proteins interact. Furthermore this technique provides a conceptually simple method for evaluating the affinity of the interaction." ; oboInOwl:hasExactSynonym "Gel Filtration", "Size Exclusion Chromatography", "Sizing column" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0071" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "molecular sieving" ; rdfs:subClassOf obo:MI_0013, obo:MI_0091 . obo:MI_0072 obo:IAO_0000115 "Western blot assay carried out using monospecific antibodies produced in the supernatant of a cell line obtained by fusing a lymphocyte B to a myeloma cell line or selected by phage display technology." ; oboInOwl:hasExactSynonym "monoclonal western" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0072" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "monoclonal antibody western blot" ; rdfs:subClassOf obo:MI_0113 . obo:MI_0073 obo:IAO_0000115 "This method relies on the covalent coupling of mRNA to the nascent polypeptide. The mRNA (natural or artificial) is first covalently linked to a short DNA linker carrying a puromycin moiety. The mRNA mixture is then translated in vitro. When the ribosome reaches the RNA-DNA junction the ribosome stalls and the puromycin moiety enters the peptidyltransferase site of the ribosome and forms a covalent linkage to the nascent polypeptide. As a result the protein and the mRNA are covalently joined and can be isolated from the ribosome and purified. In the current protocol, a cDNA strand is then synthesised to form a less sticky RNA-DNA hybrid and these complexes are finally used for affinity selection. As in most display approaches, several selections cycles (3-6) are sufficient to enrich for mRNAs encoding ligand proteins." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0073" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "mrna display" ; rdfs:subClassOf obo:MI_0034 . obo:MI_0074 obo:IAO_0000115 "Mutant molecules are produced by random or directed techniques and assayed for their ability to support binding." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0074" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "mutation analysis" ; rdfs:subClassOf obo:MI_0659 . obo:MI_0075 obo:IAO_0000115 """The protein of interest is expressed as a fusion to the peptide EUKLISEED (a fragment of the Myc oncogene protein) for which antibodies are commercially available. Sometimes multiple copies of the peptide are fused in tandem. OBSOLETE redundant term. Map to feature type: myc-tagged (MI:0522) and Interaction detection method: anti tag coimmunoprecipitation (MI:0007).""" ; oboInOwl:hasExactSynonym "myc tag coip " ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0075" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "myc tag coimmunoprecipitation" ; owl:deprecated true . obo:MI_0076 obo:IAO_0000115 "Neural networks are trained on the properties of residues belonging to a cluster of residues that are neighbours in space on protein surface. The predictor permits the inference of the residues that are likely to be on an interaction interface." ; oboInOwl:hasExactSynonym "interface predictor" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0076" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "neural network on interface properties" ; rdfs:subClassOf obo:MI_0577 . obo:MI_0077 obo:IAO_0000115 "Nuclear magnetic resonance (NMR) is an effect whereby magnetic nuclei in a magnetic field absorb and re-emit electromagnetic (EM) energy. Certain atomic nuclei, and in particular hydrogen, have a magnetic moment or spin; i.e., they have an intrinsic magnetisation, like a bar magnet. The spin aligns along the strong magnetic field, but can be changed to a misaligned excited state in response to applied radio frequency (RF) pulses of electromagnetic radiation. When the excited hydrogen nuclei relax to their aligned state, they emit RF radiation, which can be measured and displayed as a spectrum. The nature of the emitted radiation depends on the environment of each hydrogen nucleus, and if one nucleus is excited, it will influence the absorption and emission of radiation by other nuclei that lie close to it. It is consequently possible, by an ingenious elaboration of the basic NMR technique known as two-dimensional NMR, to distinguish the signals from hydrogen nuclei in different amino acid residues and to identify and measure the small shifts in these signals that occur when these hydrogen nuclei lie close enough to interact: the size of such a shift reveals the distance between the interacting pair of hydrogen atoms. In this way NMR can give information about the distances between the parts of the interacting molecule. NMR provides information about interacting atoms thereby permitting to obtain information about macromolecular structure and molecular interactions." ; oboInOwl:hasExactSynonym "NMR", "nmr" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0077" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "nuclear magnetic resonance" ; rdfs:subClassOf obo:MI_0013, obo:MI_0659 . obo:MI_0078 obo:IAO_0000115 "Identification of a nucleotide sequence. Depending on the experimental design, nucleotide sequence can be determined before the interaction detection while building a collection of clones or after the selection of randomly generated clones." ; oboInOwl:hasExactSynonym "nucleotide sequence", "sequence cloning" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0078" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "nucleotide sequence identification" ; rdfs:subClassOf obo:MI_0659, obo:MI_0661 . obo:MI_0079 obo:IAO_0000115 """Experimental methods that could not be assigned to the other large group of technologies. OBSOLETE use biochemical (MI:0401) instead.""" ; oboInOwl:hasExactSynonym "other biochemic tech" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0079" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "other biochemical technologies" ; owl:deprecated true . obo:MI_0080 obo:IAO_0000115 "Genes are recognised by hybridization of a probe with a fragment of the gene sequence." ; oboInOwl:hasExactSynonym "partial dna sequence hybrid" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0080" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "partial DNA sequence identification by hybridization" ; rdfs:subClassOf obo:MI_1180 . obo:MI_0081 obo:IAO_0000115 "The peptide synthesis methods offer numerous opportunities to synthesise and subsequently screen large arrays of synthetic peptides on planar cellulose supports. Discrete spots are arranged as arrays on membrane sheets where each spot is individually accessed by manual or automated delivery of the appropriate reagent solutions. Over the past few years protein-protein recognition, peptide-metal ion interactions, peptide-nucleic acid binding, enzymatic modification of peptides experiments, have been explored using synthetic peptide arrays on planar support." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0081" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "peptide array" ; rdfs:subClassOf obo:MI_0008 . obo:MI_0082 obo:IAO_0000115 "This approach leads to protein identification by matching peptide masses, as measured by mass spectrometry, to the ones calculated from in silico fragmentation of a protein sequence database. A peptide mixture from a tryptic digest is analysed by MALDI-MS (Matrix-assisted laser desorption ionization mass spectrometry). The list of peptide masses obtained by MALDI MS is automatically compared to the calculated masses of the predicted peptide fragments for each entry in the database. High mass accuracy is very important in order to obtain a statistically significant and unambiguous match This method is best applied to completely sequenced genomes and well characterised proteomes. However, depending on the data quality, proteins that are highly homologous to already characterised proteins (greater than 80 to 90% sequence identity) can also be identified. The retrieved sequence are evaluated by mass accuracy of the peptides, matching of additional peptide masses in the MALDI spectrum after accounting for common modifications such as oxidation, acrylamidation of cysteine and missed cleavages and the use of secondary information (apparent isoelectric point and molecular weight). If any ambiguity about the identification by MALDI-MS still exists, the results must verified by an other identification method. Peptide mass fingerprint is generally carried out with a MALDI-TOF (Matrix-assisted laser desorption ionization time-of-flight ) instrument but can also be achieved ESI-TOF (Electrospray Ionisation time-of-flight) or LC-MS (Liquid Chromatography-Mass Spectrometry) mass spectrometer." ; oboInOwl:hasExactSynonym "fingerprinting" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0082" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "peptide massfingerprinting" ; rdfs:subClassOf obo:MI_0427, obo:MI_0433 . obo:MI_0083 obo:IAO_0000115 "When one of the partners participates in the interaction with a relatively short peptide fragment, it is often convenient to precisely identify the minimal region that supports the interaction by synthesising a series of overlapping peptides and by testing them in the binding assay. Synthetic peptides that are identical with peptides synthesised in vivo are useful experimental tools for such studies. Peptides are routinely synthesised in a test tube from monomeric amino acids by condensation reactions that form peptide bonds. Peptides are constructed sequentially by coupling the C-terminus of a monomeric amino acid to the N-terminus of the growing peptide. To prevent unwanted reactions involving the amino groups and carboxyl groups of the side chains during the coupling steps, a protecting (blocking) group is attached to the side chains. Without these protecting groups, branched peptides would be generated. In the last steps of synthesis, the side chain-protecting groups are removed and the peptide is cleaved from the resin on which synthesis occurs." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0083" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "peptide synthesis" ; rdfs:subClassOf obo:MI_0093 . obo:MI_0084 obo:IAO_0000115 "Peptide sequences or entire proteins can be displayed on phage capsids by fusion to coat proteins to generate a library of fusion phages each displaying a different peptide. Such a library can then be exploited to identify specific phages that display peptides that bind to any given bait molecule for instance an antibody. The selection is performed by a series of cycles of affinity purification known as panning. The bait protein, immobilized on a solid support (plastic, agarose, sepharose, magnetic beads and others) is soaked in the phage mixture and that phage that remains attached to the bait is amplified and carried through a further affinity purification step. Each cycle results in an approximately 1,000-fold enrichment of specific phage and after a few selection rounds (2-4), DNA sequencing of the tight-binding phage reveals only a small number of sequences. Phage display panning experiments can be carried out either on libraries of peptides of random amino acid sequence or on libraries of displaying natural peptides obtained by inserting cDNA fragments into the phage vector (cDNA libraries). Libraries have been assembled on several different phages (Fd, Lambda or T7)." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0084" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "phage display" ; rdfs:subClassOf obo:MI_0034 . obo:MI_0085 obo:IAO_0000115 "The phylogenetic profile of a protein stores information about the presence and the absence of that protein in a set of genomes. By clustering identical or similar profiles, proteins with similar functions and potentially interacting are identified." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0085" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "phylogenetic profile" ; rdfs:subClassOf obo:MI_0058 . obo:MI_0086 obo:IAO_0000115 "Western blot assay carried out using a mixture of different antibodies that represent the immune response, normally in an experimental animal, to the protein of interest." ; oboInOwl:hasExactSynonym "polyclonal western" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0086" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "polyclonal antibody western blot" ; rdfs:subClassOf obo:MI_0113 . obo:MI_0087 obo:IAO_0000115 "Methods based on natural language processing to detect possible interactions between proteins (direct physical interactions or indirect genetic interactions). This includes the detection of non ambiguous protein or gene names and analysis of the relation expressed in a sentence among them." ; oboInOwl:hasExactSynonym "predictive tm" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0087" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "predictive text mining" ; rdfs:subClassOf obo:MI_0110 . obo:MI_0088 obo:IAO_0000115 "Sequences can be identified in a DNA mixture by launching a PCR (Polymerase Chain Reaction) controlled by sequence specific primers. Such reaction starts only when the hybridization of the primer with a complementary sequence occurs." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0088" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "primer specific pcr" ; rdfs:subClassOf obo:MI_0080 . obo:MI_0089 obo:IAO_0000115 "The protein array technology allows the screening of biochemical activities or binding abilities of hundreds or thousands of protein samples in parallel. After synthesis and purification by high-throughput methodologies, the proteins are printed onto the chip by using an instrument (micro-arrayer) that is capable of spotting liquid samples in a reproducible manner onto a planar support. The ordered protein array can then be probed with labelled molecules to identify proteins that bind to the bait." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0089" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "protein array" ; rdfs:subClassOf obo:MI_0008 . obo:MI_0090 obo:IAO_0000115 "In the protein-fragment complementation assay, the proteins of interest (\"Bait\" and \"Prey\") are covalently linked at the genetic level to incomplete fragments of a third protein (known as the \"reporter\") and are expressed in vivo, Interaction between the \"bait\" and the \"prey\" proteins brings the fragments of the \"reporter\" protein in close enough proximity to allow them to reform and become the functional reporter protein. Typically enzymes which confer resistance to antibiotics, such as Dihydrofolate reductase or Beta-lactamase, or proteins that give colorimetric or fluorescent signals are used. The Bait protein is generally the protein under study and the methods are readily adaptable to highthroughput mode." ; oboInOwl:hasExactSynonym "PCA", "complementation" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0090" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "protein complementation assay" ; rdfs:subClassOf obo:MI_0045 . obo:MI_0091 obo:IAO_0000115 "Used to separate and/or analyse complex mixtures. The components to be separated are distributed between two phases: a stationary phase (bed) and a mobile phase which percolates through the stationary bed. The nature of the two phases determines the separation criteria exploited by the column such as affinity, ionic charges, size or hydrophobicity of the molecules under analysis. Each type of column can be implemented with the mobile phase under atmospheric or high pressure condition. In this later case columns are designated as High Pressure Liquid Chromatography (HPLC)." ; oboInOwl:hasExactSynonym "chromatography", "column chromatography" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0091" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "chromatography technology" ; rdfs:subClassOf obo:MI_0401 . obo:MI_0092 obo:IAO_0000115 "Protein In Situ Array is a method by which protein arrays are rapidly generated in one step directly from DNA, by cell-free protein expression and simultaneous in situ immobilisation at a surface. Individual genes or fragments are produce by PCR or RT-PCR depending on the source of genetic material using properly designed primers. The PISA is generated by cell-free protein synthesis using coupled transcription and translation to produce a tagged protein, the reaction being carried out on a surface to which the protein adheres as soon as it is synthesised." ; oboInOwl:hasExactSynonym "PISA", "pisa" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0092" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "protein in situ array" ; rdfs:subClassOf obo:MI_0089 . obo:MI_0093 obo:IAO_0000115 "Single amino acid identification along a protein sequence." ; oboInOwl:hasExactSynonym "protein sequence" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0093" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "protein sequence identification" ; rdfs:subClassOf obo:MI_0661 . obo:MI_0094 obo:IAO_0000115 "A wide range of dyes have been used over the years to visualise proteins in polyacrylamide gels - Coomasie Blue and silver-staining being two classical methods. Fluorescent dyes such as Nile Red and SYPRO Orange are now increasingly used due to their superior dynamic range. Use of non-denaturing gels can allow visualisation of protein protein interactions. Several dyes can be used to specifically indicate residue modification, however this methodology will give no information as the number of residues modified or their position within the protein sequence. Examples include the use of acid fuscian or the fluorescent dansyl hydrazine to show protein glycosylation." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0094" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "protein staining" ; rdfs:subClassOf obo:MI_0659 . obo:MI_0095 obo:IAO_0000115 "ProteinChip(r) Array technology is a surface-enhanced laser desorption/ionization (SELDI) approach (Ciphergen Biosystems Inc. Fremont, CA, USA) for sample fractionation accomplished by retentate chromatography. Retentate chromatography is performed on ProteinChip Arrays with varying chromatographic properties (e.g. anion exchange, cation exchange, metal affinity and reverse phase). By utilising arrays with differing surface chemistries in parallel and in series, a complex mixture of proteins, as from cells or body fluids, can be resolved into subsets of proteins with common properties. Specific analytes can also be examined by using preactivated arrays to which a bait molecule (such as an antibody or biotinylated DNA) is immobilized and a solution containing the binding partner(s) is presented to the array. This array-based immunoprecipitation or protein-binding experiment has been used with good success to study DNA-binding proteins, receptor-ligand interactions, and protein complexes. Any ligand retained on a SELDI chip can directly be identified by mass spectrometry." ; oboInOwl:hasExactSynonym "SELDI ProteinChip", "seldi chip" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0095" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "proteinchip(r) on a surface-enhanced laser desorption/ionization" ; rdfs:subClassOf obo:MI_0089 . obo:MI_0096 obo:IAO_0000115 "A specific affinity chromatography method where a molecule of interest (bait) is bound to a column, often via an affinity tag expressed as a protein fusion (GST, HIS tag and others) or chemically linked to the bait molecule . The molecule may be expressed or synthesised and purified first, often in an heterologous system, bound to the matrix at high concentration and then challenged with a solution or cellular extract containing the candidate partner molecules. Alternatively, a multi-molecular complex may be adsorbed to the resin and the retained binding molecules subsequently identified." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:hasRelatedSynonym "affinity capture", "pulldown" ; oboInOwl:id "MI:0096" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "pull down" ; rdfs:subClassOf obo:MI_0004 . obo:MI_0097 obo:IAO_0000115 "In this complementation approach the bait can be any membrane protein (for example a receptor or a channel protein), the prey is cloned as a fusion protein of any cDNA from a library and the coding sequence of cytoplasmic RAS (cdc25 in yeast). If the bait and the prey interact, RAS is recruited close to the membrane and can activate cell growth. This procedure must take place in cells having a mutated RAS (Cdc25-2 yeast strain having a temperature sensitive mutation of RAS) to avoid constitutive growth activation." ; oboInOwl:hasExactSynonym "reverse RRS", "reverse rrs" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0097" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "reverse ras recruitment system" ; rdfs:subClassOf obo:MI_0090 . obo:MI_0098 obo:IAO_0000115 "This method permits the coupling of phenotype to genotype via the formation of a non-covalent ternary complex between mRNAs and their encoded polypeptides while they are translated in an in vitro system. As a first step a cDNA library is constructed that encodes chimeric proteins in which the natural proteins or protein domains are fused to a C-terminal tether. As a consequence when the mRNA is translated in vitro the domain can fold while the tether is still in the ribosomal tunnel. Furthermore this chimeric mRNAs lack a stop codon, thus preventing release of the mRNA and the polypeptide from the ribosome. High concentrations of magnesium and low temperature further stabilise the ternary complex. Similarly to phage display, these complexes can be used directly to select for nucleic acids encoding proteins with desired properties." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0098" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "ribosome display" ; rdfs:subClassOf obo:MI_0034 . obo:MI_0099 obo:IAO_0000115 "SPA relies upon the fact that a beta particle emitted from a radioisotope decay can excite a fluorophore only when it is at a very short distance in water solution (few micrometers). The ligand is labelled with a radioactive atom and its potential partner is fixed to fluorophore containing beads, the emitted fluorescence proving their interaction can be measured in a scintillation counter. The scintillator measures only the amount of bound radiolabelled ligand. Competition experiment with cold competitor can be done to estimate the binding affinities (50% inhibitory concentration [IC50], cold ligand versus labelled ligand). Loss of signal can also be used to measure substrate cleavage by an enzyme, and labelled antibodies used to titrate the degree of modified residue present." ; oboInOwl:hasExactSynonym "RIA Radio Immuno Assay", "SPA", "spa" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0099" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "scintillation proximity assay" ; rdfs:subClassOf obo:MI_0013 . obo:MI_0100 obo:IAO_0000115 "Multiple alignments of orthologous sequences in the same species and their corresponding phylogenetic trees are built. Every phylogenetic tree is computed as a matrix of distances between all possible interacting pairs. The covariation of the distance matrices reveals interacting pairs." ; oboInOwl:hasExactSynonym "sequence phylogeny" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0100" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "sequence based phylogenetic profile" ; rdfs:subClassOf obo:MI_0058, obo:MI_0101 . obo:MI_0101 obo:IAO_0000115 "Computational methods based on evolutionary hypothesis, used as criteria to browse sequences and predict interacting pairs." ; oboInOwl:hasExactSynonym "predict from sequenc" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0101" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "sequence based prediction" ; rdfs:subClassOf obo:MI_0063 . obo:MI_0102 obo:IAO_0000115 "This approach leads to protein identification by combining mass measurement and short amino acid sequence information obtained by tandem mass spectrometry. This information is then used to automatically find the best match in a sequence database. A mixture of peptides derived from a protease digestion is analysed by nanoelectrospray LC-MS/MS (Liquid Chromatography Tandem Mass Spectrometer or nanoESI MS/MS) mass spectrometry. Electrospray mass spectrometry cannot be applied to dilute samples and is affected by high salt. As a consequence peptides, normally extracted from acrylamide gels by in situ proteolysis, are desalted and concentrated on a microcolumn followed by elution into a capillary used for nanoelectrospray tandem mass spectrometry. A first mass spectrum (Normal mass spectrum or Q1 mass spectrum) gives information about the masses of all the peptides. Peptides observed in the normal mass spectrum are isolated in turn and dissociated into fragments by collision with gas molecules within the mass spectrometer. Some of the fragments obtained from a peptide constitute a nested set, differing by one amino acid, and the mass difference between them allows assignment of a partial sequence. The masses of the fragments define the position of the partial sequence in the peptide. Together with the cleavage specificity of the protease used to cleave the protein, and mass information such sequence tag provides much higher search specificity to match the a database entry. The procedure is repeated with several peptides from the digest, resulting in multiple identifications of the same protein or identification of several proteins from the peptide mixture. Unknown proteins can easily be identified by using the high specificity of the peptide sequence tag for searches in most sequence databases including EST or genome databases." ; oboInOwl:hasExactSynonym "sequence tag" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:hasRelatedSynonym "MS/MS" ; oboInOwl:id "MI:0102" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "sequence tag identification" ; rdfs:subClassOf obo:MI_0427, obo:MI_0433 . obo:MI_0103 obo:IAO_0000115 "A standard procedure to identify DNA fragments containing specific gene sequences. In this procedure i) a genome is fragmented using a restriction enzyme ii) the generated fragments are separated by electrophoresis iii) the fragments are transferred to a membrane iv)the membrane is incubated with a radio labelled probe that hybridises any complementary subsequence." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0103" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "southern blot" ; rdfs:subClassOf obo:MI_0080 . obo:MI_0104 obo:IAO_0000115 "In static light scattering, the average intensity of scattered light at multiple angles is measured. The data yield information on particle molecular weight, particle size and shape, and particle-particle interactions." ; oboInOwl:hasExactSynonym "sls" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0104" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "static light scattering" ; rdfs:subClassOf obo:MI_0067 . obo:MI_0105 obo:IAO_0000115 "Methods based on 3D structure information." ; oboInOwl:hasExactSynonym "predict from struct" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0105" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "structure based prediction" ; rdfs:subClassOf obo:MI_0063 . obo:MI_0106 obo:IAO_0000115 "Surface patches are built using 6 criteria: solvation potential, residue interface propensity, hydrophobicity, planarity, protrusion and accessible surface area. Protein structures having similar patches are likely to have the same interactions." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0106" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "surface patches" ; rdfs:subClassOf obo:MI_0577 . obo:MI_0107 obo:IAO_0000115 "This method measures formation of complex by monitoring changes in the resonance angle of light impinging on a gold surface as a result of changes in the refractive index of the surface. A ligand of interest (small molecule, peptide, protein, sugar, lipid, nucleic acid) is immobilized on a gold surface, and the interacting partner is injected in buffer flow over it. Biomolecules that interact with the immobilized ligand are retained on the surface, and alter the resonance angle of impinging light as a result of the change in refractive index brought about by the increased biomolecule mass retained on the surface. Since all the biomolecules belonging to the same class have the same refractive index and since there is a linear correlation between resonance angle shift and biomolecule concentration near the surface, this allows one to measure changes in concentration at the surface as a consequence of interaction. Furthermore, this is done in real time, allowing direct measurement of both the on-rate and the off-rate and of the affinity constant of complex formation." ; oboInOwl:hasExactSynonym "BIAcore(r)", "Optical biosensor", "spr" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0107" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "surface plasmon resonance" ; rdfs:subClassOf obo:MI_0659, obo:MI_0968 . obo:MI_0108 obo:IAO_0000115 "T7 is a double stranded DNA bacteriophage with a thin-walled icosahedral capsid, ~550 Angstrom in diameter, which is decorated by 415 copies of the capsid protein, the product of gene 10. gp10 can tolerate insertions at the carboxyterminus without loosing its ability to be inserted into functional phage capsids. Both low density and high density display (albeit only with short peptides) can be achieved." ; oboInOwl:hasExactSynonym "t7 phage" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0108" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:comment "Reference not index in medline: Rosenberg, A, Griffin, K, Studier, WS, McCormick, M, Berg, J, Novy, R, Mierendorf, R inNovations, 1996, 6, 1." ; rdfs:label "t7 phage display" ; rdfs:subClassOf obo:MI_0084 . obo:MI_0109 obo:IAO_0000115 """The TAP method involves the fusion of the TAP tag (encoding a calmodulin binding peptide, a TEV cleavage site, and the Staphylococcus aureus Protein A) to the target protein and the introduction of the construct into the host cell or organism, maintaining the expression of the fusion protein at, or close to, its natural level. The fusion protein and associated components are recovered from cell extracts by affinity selection on an IgG matrix. After washing, the TEV protease is added to release the bound material. The eluate is incubated with calmodulin-coated beads in the presence of calcium. This second affinity step is required to remove the TEV protease as well as traces of contaminants remaining after the first affinity selection. After washing, the bound material is released with EGTA. This two steps purification steps ensures a highly selective complex purification of the tapped protein (first round of selection on the protein A, a high affinity tag) under mild condition (non denaturant pH or conditions required to remove the tag). OBSOLETE redundant term. Map to feature type: tap tagged (MI:0524) and as interaction detection method tandem affinity purification (MI:0676).""" ; oboInOwl:hasExactSynonym "tap tag coip" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0109" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "tap tag coimmunoprecipitation" ; owl:deprecated true . obo:MI_0110 obo:IAO_0000115 "Text mining methods can be used to predict or confirm interactions by automated processing of scientific literature. Co-occurrence in the same sentence of an abstract of gene products labels are analysed to evaluate whether it represents a valid evidence of an interaction." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0110" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "text mining" ; rdfs:subClassOf obo:MI_0046 . obo:MI_0111 obo:IAO_0000115 "The gene for DHFR is rationally dissected into two fragments called F[1,2] and F[3]. Two proteins or protein domains that are thought to bind to each other can then be fused to either of the two DHFR fragments. Reconstitution of enzyme activity can be monitored in vivo by cell survival in DHFR-negative cells grown in the absence of nucleotides. A fluorescence assay can also be carried out taking advantage of fMTX binding to reconstituted DHFR. The basis of this assay is that complementary fragments of DHFR, when expressed and reassembled in cells, will bind with high affinity (Kd 5 540 pM) to fMTX in a 1:1 complex. fMTX is retained in cells by this complex, whereas the unbound fMTX is actively and rapidly transported out of the cells. Survival depends only on the number of molecules of DHFR reassembled." ; oboInOwl:hasExactSynonym "dhfr reconstruction" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0111" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "dihydrofolate reductase reconstruction" ; rdfs:subClassOf obo:MI_0090 . obo:MI_0112 obo:IAO_0000115 "The split-ubiquitin system provides a method for examining the interactions of membrane proteins. In the split-ubiquitin system, two integral membrane proteins to be studied are fused to two different ubiquitin moieties: a C-terminal ubiquitin moiety (\"Cub\", residues 35-76) and an N-terminal ubiquitin moiety (\"Nub\", residues 1-34). These fused proteins are called the bait and prey, respectively. In addition to being fused to an integral membrane protein, the Cub moiety is also fused to a transcription factor that can be cleaved off by ubiquitin specific proteases. Upon bait-prey interaction, Nub and Cub-moieties assemble, reconstituting the split-ubiquitin. The reconstituted split-ubiquitin molecule is recognized by ubiquitin specific proteases, which cleave off the reporter protein, allowing it to induce the transcription of reporter genes." ; oboInOwl:hasExactSynonym "ub reconstruction" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:hasRelatedSynonym "membrane yeast two-hybrid", "myth", "split-ubiquitin" ; oboInOwl:id "MI:0112" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "ubiquitin reconstruction" ; rdfs:subClassOf obo:MI_2412 . obo:MI_0113 obo:IAO_0000115 "Western blot is a procedure to identify and quantify proteins. A mixture of protein is first submitted to an electrophoresis in denaturing condition and then electro-transferred from the gel to a membrane. The membrane is then incubated with a primary antibody specific for a given protein or a specific residue modification in the sample under analysis. A secondary antibody, radiolabelled or fused to fluorophore or to a chromogenic enzyme, targets the first antibody and allows the visualisation of the protein band on the membrane." ; oboInOwl:hasExactSynonym "Immuno blot" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0113" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "western blot" ; rdfs:subClassOf obo:MI_0421, obo:MI_0659 . obo:MI_0114 obo:IAO_0000115 "Analysis of a diffraction pattern generated by a single crystal. X-rays have a wavelength, typically around 1 Angstrom (the diameter of a hydrogen atom). If a narrow parallel beam of X-rays is directed at a sample of a pure protein, most of the X-rays will pass straight through it. A small fraction, however, will be scattered by the atoms in the sample. If the sample is a well-ordered crystal, the scattered waves will reinforce one another at certain points and will appear as diffraction spots when the X-rays are recorded by a suitable detector. The position and intensity of each spot in the X-ray diffraction pattern contain information about the position and nature of the atoms in the crystal. The three-dimensional structure of a large molecule can be deduced from the electron-density map of its crystal. In recent years X-ray diffraction analysis has become increasingly automated, and now the slowest step is likely to be the production of suitable macromolecule crystals. This requires high concentration of very pure macromolecule and empirical searching for the proper crystallization conditions." ; oboInOwl:hasExactSynonym "X-ray", "x-ray diffraction" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:hasRelatedSynonym "co-crystallization", "co-crystallography" ; oboInOwl:id "MI:0114" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "x-ray crystallography" ; rdfs:subClassOf obo:MI_0013, obo:MI_0659 . obo:MI_0115 obo:IAO_0000115 "The proteins are displayed on the surface of the yeast S. cerevisiae by fusion to signal sequences for protein secretion. This method is limited by the low efficiency of the yeast display system but can take full advantage of exploiting cell sorting methods (FACS) to isolate cells that display molecules with desired binding properties." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0115" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "yeast display" ; rdfs:subClassOf obo:MI_0034, obo:MI_0054 . obo:MI_0116 obo:IAO_0000115 "Property of a subsequence that may interfere with the binding of a molecule." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0116" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "feature type" ; rdfs:subClassOf obo:MI_0000 . obo:MI_0117 obo:IAO_0000115 "A region of a molecule or a component of a complex identified as being involved in an interaction. This may or may not be a region of the molecule in direct contact with the interacting partner." ; oboInOwl:hasBroadSynonym "binding site" ; oboInOwl:hasExactSynonym "binding region" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:hasRelatedSynonym "binding component" ; oboInOwl:id "MI:0117" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "binding-associated region" ; rdfs:subClassOf obo:MI_0252 . obo:MI_0118 obo:IAO_0000115 "A change in a sequence or structure in comparison to a reference entity due to a insertion, deletion or substitution event." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0118" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "mutation" ; rdfs:subClassOf obo:MI_0252 . obo:MI_0119 obo:IAO_0000115 "Region of a molecule whose mutation or deletion decreases significantly interaction strength or rate (in the case of interactions inferred from enzymatic reaction)." ; oboInOwl:hasExactSynonym "hotspot", "mutation decreasing" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0119" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "mutation decreasing interaction" ; rdfs:subClassOf obo:MI_0118 . obo:MI_0120 obo:IAO_0000115 """Residue covalent modifications occurring in the specific protein form involved in an interaction. OBSOLETE remap to MOD:00000.""" ; oboInOwl:hasExactSynonym "ptm" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0120" ; a owl:Class ; rdfs:label "post translation modification" ; owl:deprecated true . obo:MI_0121 obo:IAO_0000115 """Residue modification. OBSOLETE remap to MOD:00394.""" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0121" ; a owl:Class ; rdfs:label "acetylated residue" ; owl:deprecated true . obo:MI_0122 obo:IAO_0000115 """Residue modification. OBSOLETE remap to MOD:00050.""" ; oboInOwl:hasExactSynonym "(S)-2-(acetylamino)propanoic acid", "AAC", "N-acetyl-L-alanine", "[A:ac]", "acetylalanine" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0122" ; a owl:Class ; rdfs:label "n-acetyl-alanine" ; owl:deprecated true . obo:MI_0123 obo:IAO_0000115 """Residue modification. OBSOLETE remap to MOD:00359.""" ; oboInOwl:hasExactSynonym "N2-acetyl-L-arginine", "RAC", "[R:ac]", "acetylarginine", "alpha-acetylamino-delta-guanidinovaleric acid" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0123" ; a owl:Class ; rdfs:label "n2-acetyl-arginine" ; owl:deprecated true . obo:MI_0124 obo:IAO_0000115 """Residue modification. OBSOLETE remap to MOD:00780.""" ; oboInOwl:hasExactSynonym "N-acetyl-L-asparagine", "NAC", "[N:ac]", "acetylasparagine" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0124" ; a owl:Class ; rdfs:label "n-acetyl-asparagine" ; owl:deprecated true . obo:MI_0125 obo:IAO_0000115 """Residue modification. OBSOLETE remap to MOD:00051.""" ; oboInOwl:hasExactSynonym "(S)-2-(acetylamino)butanedioic acid", "DAC", "N-acetyl-L-aspartic acid", "[D:ac]", "acetylaspartate", "acetylaspartic acid" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0125" ; a owl:Class ; rdfs:label "n-acetyl-aspartic acid" ; owl:deprecated true . obo:MI_0126 obo:IAO_0000115 """Residue modification. OBSOLETE remap to MOD:00052.""" ; oboInOwl:hasExactSynonym "(R)-2-acetylamino-3-sulfanylpropanoic acid", "2-acetylamino-3-mercaptopropanoic acid", "CAC", "N-acetyl-L-cysteine", "N-acetylcysteine", "[C:ac]", "acetylcysteine" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0126" ; a owl:Class ; rdfs:label "n-acetyl-cysteine" ; owl:deprecated true . obo:MI_0127 obo:IAO_0000115 """Residue modification. OBSOLETE remap to MOD:00054.""" ; oboInOwl:hasExactSynonym "(S)-2-acetylamino-5-pentanediamic acid", "N-acetyl-L-glutamine", "QAC", "[Q:ac]", "acetylglutamine" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0127" ; a owl:Class ; rdfs:label "n-acetyl-glutamine" ; owl:deprecated true . obo:MI_0128 obo:IAO_0000115 """Residue modification. OBSOLETE remap to MOD:00053.""" ; oboInOwl:hasExactSynonym "(S)-2-(acetylamino)pentanedioic acid", "EAC", "N-acetyl-L-glutamic acid", "[E:ac]", "acetylglutamate", "acetylglutamic acid" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0128" ; a owl:Class ; rdfs:label "n-acetyl-glutamic acid" ; owl:deprecated true . obo:MI_0129 obo:IAO_0000115 """Residue modification. OBSOLETE remap to MOD:00055.""" ; oboInOwl:hasExactSynonym "2-(acetylamino)ethanoic acid", "GAC", "N-acetylglycine", "[G:ac]", "aceturic acid", "acetylglycine" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0129" ; a owl:Class ; rdfs:label "n-acetylglycine" ; owl:deprecated true . obo:MI_0130 obo:IAO_0000115 """Residue modification. OBSOLETE remap to MOD:00781.""" ; oboInOwl:hasExactSynonym "HAC", "N-acetyl-L-histidine", "[H:ac]", "acetylhistidine" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0130" ; a owl:Class ; rdfs:label "n-acetyl-histidine" ; owl:deprecated true . obo:MI_0131 obo:IAO_0000115 """Residue modification. OBSOLETE remap to MOD:00056.""" ; oboInOwl:hasExactSynonym "(2S,3S)-2-acetylamino-3-methylpentanoic acid", "IAC", "N-acetyl-L-isoleucine", "[I:ac]", "acetylisoleucine" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0131" ; a owl:Class ; rdfs:label "n-acetyl-isoleucine" ; owl:deprecated true . obo:MI_0132 obo:IAO_0000115 """Residue modification. OBSOLETE remap to MOD:00782.""" ; oboInOwl:hasExactSynonym "LAC", "N-acetyl-L-leucine", "[L:ac]", "acetylleucine" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0132" ; a owl:Class ; rdfs:label "n-acetyl-leucine" ; owl:deprecated true . obo:MI_0133 obo:IAO_0000115 """Residue modification. OBSOLETE remap to MOD:00057.""" ; oboInOwl:hasExactSynonym "(S)-2-acetylamino-6-aminohexanoic acid", "KAC", "N2-acetyl-L-lysine", "N2-acetyllysine", "[K:ac]", "n2-acetyllysine" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0133" ; a owl:Class ; rdfs:label "n2-acetyl-lysine" ; owl:deprecated true . obo:MI_0134 obo:IAO_0000115 """Residue modification. OBSOLETE remap to MOD:00064.""" ; oboInOwl:hasExactSynonym "(S)-2-amino-6-(acetylamino)hexanoic acid", "KA6", "N(zeta)-acetyllysine", "N6-acetyl-L-lysine", "[K:N6ac]", "epsilon-acetyllysine", "n6-acetyllysine" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0134" ; a owl:Class ; rdfs:label "n6-acetyl-lysine" ; owl:deprecated true . obo:MI_0135 obo:IAO_0000115 """Residue modification. OBSOLETE remap to MOD:00058.""" ; oboInOwl:hasExactSynonym "(S)-2-acetylamino-4-(methylsulfanyl)butanoic acid", "2-acetylamino-4-(methylthio)butanoic acid", "MAC", "N-acetyl-L-methionine", "[M:ac]", "acetylmethionine", "methionamine" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0135" ; a owl:Class ; rdfs:label "n-acetyl-methionine" ; owl:deprecated true . obo:MI_0136 obo:IAO_0000115 """Residue modification. OBSOLETE remap to MOD:00784.""" ; oboInOwl:hasExactSynonym "FAC", "N-acetyl-L-phenylalanine", "[F:ac]", "acetylphenylalanine" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0136" ; a owl:Class ; rdfs:label "n-acetyl-phenylalanine" ; owl:deprecated true . obo:MI_0137 obo:IAO_0000115 """Residue modification. OBSOLETE remap to MOD:00059.""" ; oboInOwl:hasExactSynonym "(2S)-1-acetyl-2-pyrrolidinecarboxylic acid", "N-acetyl-L-proline", "PAC", "[P:ac]", "acetylproline" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0137" ; a owl:Class ; rdfs:label "n-acetyl-proline" ; owl:deprecated true . obo:MI_0138 obo:IAO_0000115 """Residue modification. OBSOLETE remap to MOD:00060.""" ; oboInOwl:hasExactSynonym "(S)-2-acetylamino-3-hydroxypropanoic acid", "N-acetyl-L-serine", "N-acetylserine", "SAC", "[S:ac]", "acetylserine" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0138" ; a owl:Class ; rdfs:label "n-acetyl-serine" ; owl:deprecated true . obo:MI_0139 obo:IAO_0000115 """Residue modification. OBSOLETE remap to MOD:00061.""" ; oboInOwl:hasExactSynonym "(2S,3R)-2-acetylamino-3-hydroxybutanoic acid", "N-acetyl-L-threonine", "N-acetylthreonine", "TAC", "[T:ac]", "acetylthreonine" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0139" ; a owl:Class ; rdfs:label "n-acetyl-threonine" ; owl:deprecated true . obo:MI_0140 obo:IAO_0000115 """Residue modification. OBSOLETE remap to MOD:00785.""" ; oboInOwl:hasExactSynonym "N-acetyl-L-tryptophan", "WAC", "[W:ac]", "acetyltryptophan" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0140" ; a owl:Class ; rdfs:label "n-acetyl-tryptophan" ; owl:deprecated true . obo:MI_0141 obo:IAO_0000115 """Residue modification. OBSOLETE remap to MOD:00062.""" ; oboInOwl:hasExactSynonym "(S)-2-acetylamino-3-(4-hydoxyphenyl)propanoic acid", "N-acetyl-L-tyrosine", "N-acetyltyrosine", "YAC", "[Y:ac]", "acetyltyrosine" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0141" ; a owl:Class ; rdfs:label "n-acetyl-tyrosine" ; owl:deprecated true . obo:MI_0142 obo:IAO_0000115 """Residue modification. OBSOLETE remap to MOD:00063.""" ; oboInOwl:hasExactSynonym "(S)-2-acetylamino-3-methylbutanoic acid", "N-acetyl-L-valine", "N-acetylvaline", "VAC", "[V:ac]", "acetylvaline" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0142" ; a owl:Class ; rdfs:label "n-acetyl-valine" ; owl:deprecated true . obo:MI_0143 obo:IAO_0000115 """Residue modification. OBSOLETE remap to MOD:00674.""" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0143" ; a owl:Class ; rdfs:label "amidated residue" ; owl:deprecated true . obo:MI_0145 obo:IAO_0000115 """Residue modification. OBSOLETE remap to MOD:00091.""" ; oboInOwl:hasExactSynonym "(S)-2-amino-5-guanidinopentanamide", "L-arginine amide", "RAM", "[R:am]", "argininamide", "arginineamide" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0145" ; a owl:Class ; rdfs:label "arginine amide" ; owl:deprecated true . obo:MI_0146 obo:IAO_0000115 """Residue modification. OBSOLETE remap to MOD:00493.""" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0146" ; a owl:Class ; rdfs:label "formylated residue" ; owl:deprecated true . obo:MI_0147 obo:IAO_0000115 """Residue modification. OBSOLETE remap to MOD:00030.""" ; oboInOwl:hasExactSynonym "(S)-2-formylamino-4-(methylsulfanyl)butanoic acid", "2-formylamino-4-(methylthio)butanoic acid", "MFM", "N-formyl-L-methionine", "[M:form]", "formylmethionine" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0147" ; a owl:Class ; rdfs:label "n-formyl-methionine" ; owl:deprecated true . obo:MI_0148 obo:IAO_0000115 """Residue modification. OBSOLETE remap to MOD:00428.""" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0148" ; a owl:Class ; rdfs:label "hydroxylated residue" ; owl:deprecated true . obo:MI_0150 obo:IAO_0000115 """Residue modification. OBSOLETE remap to MOD:01155.""" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0150" ; a owl:Class ; rdfs:label "lipid modification" ; owl:deprecated true . obo:MI_0151 obo:IAO_0000115 """Residue modification. OBSOLETE remap to MOD:00111.""" ; oboInOwl:hasExactSynonym "(R,E,E)-2-amino-3-(3,7,11-trimethyl-2,6,10-dodecatrienylsulfanyl)propanoic acid", "2-amino-3-(3,7,11-trimethyl-2,6,10-dodecatrienylthio)propanoic acid", "CFN", "S-farnesyl-L-cysteine", "[C:farn]", "farnesylcysteine" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0151" ; a owl:Class ; rdfs:label "s-farnesyl-cysteine" ; owl:deprecated true . obo:MI_0152 obo:IAO_0000115 """Residue modification. OBSOLETE remap to MOD:00113.""" ; oboInOwl:hasExactSynonym "(R,E,E,E)-2-amino-3-(3,7,11,15-tetramethyl-2,6,10,14-hexadecatetraenylsulfanyl)propanoic acid", "2-amino-3-(3,7,11,15-tetramethyl-2,6,10,14-hexadecatetraenylthio)propanoic acid", "CGR", "S-geranylgeranyl-L-cysteine", "[C:ger]", "geranylgeranylcys" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0152" ; a owl:Class ; rdfs:label "s-geranylgeranyl-cysteine" ; owl:deprecated true . obo:MI_0153 obo:IAO_0000115 """Residue modification. OBSOLETE remap to MOD:00069.""" ; oboInOwl:hasExactSynonym "(R)-2-hexadecanoylamino-3-sulfanylpropanoic acid", "2-hexadecanoylamino-3-mercaptopropanoic acid", "CPN", "N-(1-oxahexadecyl)-L-cysteine", "N-palmitoyl-L-cysteine", "[C:palm_n]", "n-palmitoylcysteine" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0153" ; a owl:Class ; rdfs:label "n-palmitoyl-cysteine" ; owl:deprecated true . obo:MI_0154 obo:IAO_0000115 """Residue modification. OBSOLETE remap to MOD:00115.""" ; oboInOwl:hasExactSynonym "(R)-2-amino-3-(hexadecanoylsulfanyl)propanoic acid", "2-amino-3-(hexadecanoylthio)propanoic acid", "CPS", "S-palmitoyl-L-cysteine", "[C:palm_s]", "cysteine hexadecanoate thioester", "cysteine palmitate thioester", "s-palmitoylcysteine" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0154" ; a owl:Class ; rdfs:label "s-palmitoyl-cysteine" ; owl:deprecated true . obo:MI_0155 obo:IAO_0000115 """Residue modification. OBSOLETE remap to MOD:00068.""" ; oboInOwl:hasExactSynonym "GMY", "N-myristoyl-glycine", "[G:myr]", "myristoylglycine" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0155" ; a owl:Class ; rdfs:label "n-myristoyl-glycine" ; owl:deprecated true . obo:MI_0156 obo:IAO_0000115 """Residue modification. OBSOLETE remap to MOD:00087.""" ; oboInOwl:hasExactSynonym "(S)-2-amino-6-(tetradecanoylamino)hexanoic acid", "KMY", "N(zeta)-myristoyllysine", "N6-(1-oxotetradecyl)-L-lysine", "N6-myristoyl-L-lysine", "[K:myr]", "epsilon-myristoyllysine", "myristoyllysine" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0156" ; a owl:Class ; rdfs:label "n6-myristoyl-lysine" ; owl:deprecated true . obo:MI_0157 obo:IAO_0000115 """Residue modification. OBSOLETE remap to MOD:00427.""" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0157" ; a owl:Class ; rdfs:label "methylated residue" ; owl:deprecated true . obo:MI_0158 obo:IAO_0000115 """Residue modification. OBSOLETE remap to MOD:00070.""" ; oboInOwl:hasExactSynonym "(S)-2-methylaminopropanoic acid", "AMT", "N-methyl-L-alanine", "N-methylalanine", "[A:meth_n]", "methylalanine" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0158" ; a owl:Class ; rdfs:label "n-methyl-alanine" ; owl:deprecated true . obo:MI_0159 obo:IAO_0000115 """Residue modification. OBSOLETE remap to MOD:00071.""" ; oboInOwl:hasExactSynonym "(S)-1-carboxy-N,N,N-trimethylethanaminium", "(S)-2-(trimethylammonio)propanoic acid", "AM3", "N,N,N-trimethyl-L-alanine", "[A:meth_n3]", "trimethylalanine" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0159" ; a owl:Class ; rdfs:label "n,n,n-trimethyl-alanine" ; owl:deprecated true . obo:MI_0160 obo:IAO_0000115 """Residue modification. OBSOLETE remap to MOD:00077.""" ; oboInOwl:hasExactSynonym "(S)-2-amino-5-[((dimethylamino)iminomethyl)amino]pentanoic acid", "NG,NG-dimethylarginine", "RM2", "[R:meth_n7]", "asymmetric dimethylarginine", "dimethylarginine", "omega-N,omega-N-dimethyl-L-arginine" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0160" ; a owl:Class ; rdfs:label "omega-n,omega-n-dimethyl-arginine" ; owl:deprecated true . obo:MI_0161 obo:IAO_0000115 """Residue modification. OBSOLETE remap to MOD:00237.""" ; oboInOwl:hasExactSynonym "(2R,3Xi)-2-amino-3-methylsulfanylbutanedioic acid", "3-carboxy-S-methyl-cysteine", "3-methylthio-aspartic acid", "DM2", "L-beta-methylthioaspartic acid", "[D:meth_b]", "beta-methylthio-aspartic acid", "methylthioaspartate" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0161" ; a owl:Class ; rdfs:label "beta-methylthioaspartic acid" ; owl:deprecated true . obo:MI_0162 obo:IAO_0000115 """Residue modification. OBSOLETE remap to MOD:00080.""" ; oboInOwl:hasExactSynonym "(S)-2-amino-N5-methylpentanediamic acid", "N(delta)-methylglutamine", "N-methylglutamine", "N5-methyl-L-glutamine", "QM5", "[Q:meth_n5]", "gamma-methylglutamine", "methylglutamine" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0162" ; a owl:Class ; rdfs:label "n5-methyl-glutamine" ; owl:deprecated true . obo:MI_0163 obo:IAO_0000115 """Residue modification. OBSOLETE remap to MOD:00081.""" ; oboInOwl:hasExactSynonym "(S)-2-aminopentanedioic acid 5-methyl ester", "5-methyl-L-glutamate", "EM5", "L-glutamic acid 5-methyl ester", "[E:meth_o5]", "glutamatemethylester", "glutamic acid gamma-methyl ester" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0163" ; a owl:Class ; rdfs:label "glutamic acid 5-methyl ester" ; owl:deprecated true . obo:MI_0165 obo:IAO_0000115 """Residue modification. OBSOLETE remap to MOD:00085.""" ; oboInOwl:hasExactSynonym "(S)-2-amino-6-methylaminohexanoic acid", "MLZ", "N(zeta)-methyllysine", "N6-methyl-L-lysine", "[K:meth_1]", "epsilon-methyllysine", "methyllysine" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0165" ; a owl:Class ; rdfs:label "n6-methyl-lysine" ; owl:deprecated true . obo:MI_0166 obo:IAO_0000115 """Residue modification. OBSOLETE remap to MOD:00084.""" ; oboInOwl:hasExactSynonym "(S)-2-amino-6-dimethylaminohexanoic acid", "MLY", "N(zeta)-dimethyllysine", "N6,N6-dimethyl-L-lysine", "[K:meth_2]", "dimethyllysine", "epsilon-dimethyllysine", "lysine derivative Lys(y)" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0166" ; a owl:Class ; rdfs:label "n6,n6-dimethyl-lysine" ; owl:deprecated true . obo:MI_0167 obo:IAO_0000115 """Residue modification. OBSOLETE remap to MOD:00083.""" ; oboInOwl:hasExactSynonym "(S)-2-amino-6-(trimethylammonio)hexanoic acid", "(S)-5-amino-5-carboxy-N,N,N-trimethylpentanaminium", "M3L", "N(zeta)-trimethyllysine", "N6,N6,N6-trimethyl-L-lysine", "[K:meth_3]", "epsilon-trimethyllysine", "trimethyllysine" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0167" ; a owl:Class ; rdfs:label "n6,n6,n6-trimethyl-lysine" ; owl:deprecated true . obo:MI_0168 obo:IAO_0000115 """Residue modification. OBSOLETE remap to MOD:00073.""" ; oboInOwl:hasExactSynonym "(S)-2-methylamino-4-(methylsulfanyl)butanoic acid", "2-methylamino-4-(methylthio)butanoic acid", "MMT", "N-methyl-L-methionine", "N-methylmethionine", "[M:meth]", "methylmethionine" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0168" ; a owl:Class ; rdfs:label "n-methyl-methionine" ; owl:deprecated true . obo:MI_0169 obo:IAO_0000115 """Residue modification. OBSOLETE remap to MOD:00074.""" ; oboInOwl:hasExactSynonym "(S)-2-methylamino-3-phenylpropanoic acid", "FMT", "N-methyl-L-phenylalanine", "N-methylphenylalanine", "[F:meth]", "methylphenylalanine" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0169" ; a owl:Class ; rdfs:label "n-methyl-phenylalanine" ; owl:deprecated true . obo:MI_0170 obo:IAO_0000115 """Residue modification. OBSOLETE remap to MOD:00696.""" ; oboInOwl:hasExactSynonym "phosphorylated" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0170" ; a owl:Class ; rdfs:label "phosphorylated residue" ; owl:deprecated true . obo:MI_0171 obo:IAO_0000115 """Residue modification. OBSOLETE remap to MOD:00227.""" ; oboInOwl:hasExactSynonym "(S)-2-amino-5-[imino(phosphonoamino)methyl]aminopentanoic acid", "N5-[imino(phosphonoamino)methyl]-L-ornithine", "RPO", "[R:po]", "alpha-amino-delta-phosphonoguanidinovaleric acid", "omega-N-phospho-L-arginine", "phosphoarginine" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0171" ; a owl:Class ; rdfs:label "omega-n-phospho-arginine" ; owl:deprecated true . obo:MI_0172 obo:IAO_0000115 """Residue modification. OBSOLETE remap to MOD:00042.""" ; oboInOwl:hasExactSynonym "(S)-2-aminobutanedioic 4-phosphoric anhydride", "DPO", "L-aspartic 4-phosphoric anhydride", "[D:po]", "beta-aspartyl phosphate", "phosphoaspartic acid" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0172" ; a owl:Class ; rdfs:label "aspartic 4-phosphoric anhydride" ; owl:deprecated true . obo:MI_0173 obo:IAO_0000115 """Residue modification. OBSOLETE remap to MOD:00043.""" ; oboInOwl:hasExactSynonym "(R)-2-amino-3-(phosphonosulfanyl)propanoic acid", "CPO", "S-phospho-L-cysteine", "S-phosphonocysteine", "S3-phosphocysteine", "[C:po]", "cysteine phosphate thioester", "phosphocysteine" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0173" ; a owl:Class ; rdfs:label "s-phospho-cysteine" ; owl:deprecated true . obo:MI_0176 obo:IAO_0000115 """Residue modification. OBSOLETE remap to MOD:00046.""" ; oboInOwl:hasExactSynonym "(S)-2-amino-3-(phosphonooxy)propanoic acid", "2-amino-3-hydroxypropanoic acid 3-phosphate", "2-amino-3-hydroxypropanoic acid 3-phosphate;O-phosphonoserine;O3-phosphoserine", "O-phospho-L-serine", "O-phosphonoserine", "O3-phosphoserine", "SPO", "[S:po]", "phosphoserine", "serine phosphate ester" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0176" ; a owl:Class ; rdfs:label "o-phospho-serine" ; owl:deprecated true . obo:MI_0177 obo:IAO_0000115 """Residue modification. OBSOLETE remap to MOD:00047.""" ; oboInOwl:hasExactSynonym "(2S,3R)-2-amino-3-phosphonooxybutanoic acid", "2-amino-3-hydroxybutanoic acid 3-phosphate", "O-phospho-L-threonine", "O3-phosphothreonine", "TPO", "[T:po]", "phosphothreonine", "threonine phosphate ester" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0177" ; a owl:Class ; rdfs:label "o-phospho-threonine" ; owl:deprecated true . obo:MI_0178 obo:IAO_0000115 """Residue modification. OBSOLETE remap to MOD:00048.""" ; oboInOwl:hasExactSynonym "(S)-2-amino-3-(4-phosphonooxyphenyl)propanoic acid", "2-amino-3-(4-hydroxyphenyl)propanoic acid 4'-phosphate", "O4'-phospho-L-tyrosine", "O4-phosphotyrosine", "YPO", "[Y:po]", "phosphotyrosine", "tyrosine phosphate" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0178" ; a owl:Class ; rdfs:label "o4'-phospho-tyrosine" ; owl:deprecated true . obo:MI_0179 obo:IAO_0000115 """Residue modification. OBSOLETE remap to MOD:00032.""" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0179" ; a owl:Class ; rdfs:label "other modification" ; owl:deprecated true . obo:MI_0180 obo:IAO_0000115 """Residue modification. OBSOLETE remap to MOD:00031.""" ; oboInOwl:hasExactSynonym "3-selenylalanine", "CSE", "L-selenocysteine", "[C:sel]", "selenium cysteine" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0180" ; a owl:Class ; rdfs:label "selenocysteine" ; owl:deprecated true . obo:MI_0181 obo:IAO_0000115 """Residue modification. OBSOLETE remap to MOD:00530.""" ; oboInOwl:hasExactSynonym "L-selenomethionine", "MSE", "[M:sel]" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0181" ; a owl:Class ; rdfs:label "selenomethionine" ; owl:deprecated true . obo:MI_0182 obo:IAO_0000115 """Residue modification. OBSOLETE remap to MOD:01169.""" ; oboInOwl:hasExactSynonym "(S)-2-amino-3-oxopropanoic acid", "2-amino-3-oxopropionic acid", "L-3-oxoalanine", "L-alpha-formylglycine", "L-amino-malonic acid semialdehyde", "L-aminomalonaldehydic acid", "L-serinesemialdehyde [misnomer]", "SOX", "[S:oxal]", "oxoalanine" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0182" ; a owl:Class ; rdfs:label "3-oxoalanine" ; owl:deprecated true . obo:MI_0184 obo:IAO_0000115 """Residue modification. OBSOLETE remap to MOD:00179.""" ; oboInOwl:hasExactSynonym "(S)-2-amino-5-[2-([([2,3-dihydroxypropyl]oxy)(hydroxy)phosphoryl]oxy)ethyl]amino-5-oxopentanoic acid", "EGE", "L-glutamyl 5-glycerophosphoethanolamine", "L-glutamyl 5-glycerophosphorylethanolamine", "L-glutamyl 5-glycerylphosphorylethanolamine", "[E:gpe]", "glycerylpo4etohamine" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0184" ; a owl:Class ; rdfs:label "glutamyl 5-glycerylphosphorylethanolamine" ; owl:deprecated true . obo:MI_0186 obo:IAO_0000115 """Residue modification. OBSOLETE remap to MOD:00126.""" ; oboInOwl:hasExactSynonym "(3aS-(3aalpha,4beta,6aalpha))-N6-(5-(hexahydro-2-oxo-1H-thieno(3,4-d)imidazol-4-yl)-1-oxopentyl)-L-lysine", "(S)-2-amino-6-[5-((3aS,4S,6aR)-hexahydro-2-oxo-1H-thieno[3,4-d]imidazol-4-yl)-1-oxopentyl]aminohexanoic acid", "KBT", "N6-[5-((3aS,4S,6aR)-hexahydro-2-oxo-1H-thieno[3,4-d]imidazol-4-yl)-1-oxopentyl]-L-lysine", "N6-biotinyl-L-lysine", "N6-biotinyllysine", "[K:biotin]", "biocytin", "biotinyllysine", "epsilon-N-biotinyllysine" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0186" ; a owl:Class ; rdfs:label "n6-biotinyl-lysine" ; owl:deprecated true . obo:MI_0187 obo:IAO_0000115 """Residue modification. OBSOLETE remap to MOD:00125.""" ; oboInOwl:hasExactSynonym "(S,R)-2-amino-6-(4-amino-2-hydroxybutylamino)hexanoic acid", "KHY", "N6-(4-amino-2-hydroxybutyl)-L-lysine", "[K:hypu]", "hypusine" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0187" ; a owl:Class ; rdfs:label "n6-(4-amino-2-hydroxybutyl)-lysine" ; owl:deprecated true . obo:MI_0188 obo:IAO_0000115 """Residue modification. OBSOLETE remap to MOD:00129.""" ; oboInOwl:hasExactSynonym "(S)-2-amino-6-[(2E,4E,6E,8E)-3,7-dimethyl-9-(2,6,6-trimethylcyclohex-1-en-1-yl)-2,4,6,8-nonatetraenylidene]aminohexanoic acid", "KRT", "N6-retinal-L-lysine", "N6-retinyl-lysine", "N6-retinylidene-L-lysine", "[K:retin]", "retinallysine" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0188" ; a owl:Class ; rdfs:label "n6-retinal-lysine" ; owl:deprecated true . obo:MI_0189 obo:IAO_0000115 """Residue modification due to a cross-link between a lysine and a glycine from the ubiquitine protein. OBSOLETE remap to MOD:00134.""" ; oboInOwl:hasExactSynonym "KUB", "N6-glycyl-L-lysine", "N6-glycyllysine", "[K:ub]" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0189" ; a owl:Class ; rdfs:label "ubiquitinated lysine" ; owl:deprecated true . obo:MI_0190 obo:IAO_0000115 "Connection between molecule." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0190" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "interaction type" ; rdfs:subClassOf obo:MI_0000 . obo:MI_0191 obo:IAO_0000115 """Physical association among molecules. OBSOLETE since too non-specific. Consider using physical interaction (MI:0218) instead.""" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0191" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "aggregation" ; owl:deprecated true . obo:MI_0192 obo:IAO_0000115 "Reaction, that can affect K,C,A,D,E,Q,G,I,K,M,P,S,T,Y,V residues." ; oboInOwl:hasExactSynonym "acetylation" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0192" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "acetylation reaction" ; rdfs:subClassOf obo:MI_0414 . obo:MI_0193 obo:IAO_0000115 "Irreversible reaction that can affect A,R,N,D,C,Q,E,G,H,I,L,K,M,F,P,S,T,W,Y or V residues. It involves the addition of an amide group from a glycine to the target residue." ; oboInOwl:hasExactSynonym "amidation" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0193" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "amidation reaction" ; rdfs:subClassOf obo:MI_0414 . obo:MI_0194 obo:IAO_0000115 "Covalent bond breakage in a molecule leading to the formation of smaller molecules." ; oboInOwl:hasExactSynonym "cleavage" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0194" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "cleavage reaction" ; rdfs:subClassOf obo:MI_0414 . obo:MI_0195 obo:IAO_0000115 "Interaction leading to the formation of covalent bond within an autocatalytic molecule or between partners." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0195" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "covalent binding" ; rdfs:subClassOf obo:MI_0407 . obo:MI_0196 obo:IAO_0000115 """Physical interaction mediated by covalent bond rearrangement. OBSOLETE use covalent binding (MI:0195) instead.""" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0196" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "covalent interaction" ; owl:deprecated true . obo:MI_0197 obo:IAO_0000115 "N6-acetyl-L-lysine or S-acetyl-L-cysteine are cleaved and return K or C residues." ; oboInOwl:hasExactSynonym "deacetylation" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0197" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "deacetylation reaction" ; rdfs:subClassOf obo:MI_0414 . obo:MI_0198 obo:IAO_0000115 "S-farnesyl-L-cysteined is cleaved and returns a C residue." ; oboInOwl:hasExactSynonym "defarnesylation" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0198" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "defarnesylation reaction" ; rdfs:subClassOf obo:MI_0212 . obo:MI_0199 obo:IAO_0000115 "N6-formyl-L-lysine is cleaved and returns a K residue." ; oboInOwl:hasExactSynonym "deformylation" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0199" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "deformylation reaction" ; rdfs:subClassOf obo:MI_0414 . obo:MI_0200 obo:IAO_0000115 "S-geranylgeranyl-L-cysteine is cleaved and returns a C residue." ; oboInOwl:hasExactSynonym "degeranylation" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0200" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "degeranylation reaction" ; rdfs:subClassOf obo:MI_0212 . obo:MI_0201 obo:IAO_0000115 "N6-myristoyl-L-lysine is cleaved and returns a K residue." ; oboInOwl:hasExactSynonym "demyristoylation" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0201" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "demyristoylation reaction" ; rdfs:subClassOf obo:MI_0212 . obo:MI_0202 obo:IAO_0000115 "S-palmitoyl-L-cysteine, N6-palmitoyl-L-lysine, O-palmitoyl-L-threonine or O-palmitoyl-L-serine are cleaved and return C,K,T or S residues." ; oboInOwl:hasExactSynonym "depalmitoylation" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0202" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "depalmitoylation reaction" ; rdfs:subClassOf obo:MI_0212 . obo:MI_0203 obo:IAO_0000115 "Phosphoresidues are cleaved and return D,C,H,S,T,Y or R residues." ; oboInOwl:hasExactSynonym "dephosphorylation" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0203" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "dephosphorylation reaction" ; rdfs:subClassOf obo:MI_0414 . obo:MI_0204 obo:IAO_0000115 "Cleavage of the G-K bond and release of ubiquitin or ubiquitin like proteins." ; oboInOwl:hasExactSynonym "deubiquitination" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0204" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "deubiquitination reaction" ; rdfs:subClassOf obo:MI_0414 . obo:MI_0205 obo:IAO_0000115 """Dissociation of partners interacting via non-covalent bond. OBSOLETE because considered misleading.""" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0205" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "disaggregation" ; owl:deprecated true . obo:MI_0206 obo:IAO_0000115 "Reversible reaction that can affect C residue." ; oboInOwl:hasExactSynonym "farnesylation" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0206" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "farnesylation reaction" ; rdfs:subClassOf obo:MI_0211 . obo:MI_0207 obo:IAO_0000115 "Reaction that can affect K or G residues. Reside is functionalised with a formyl group." ; oboInOwl:hasExactSynonym "formylation" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0207" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "formylation reaction" ; rdfs:subClassOf obo:MI_0414 . obo:MI_0208 obo:IAO_0000115 """An effect in which two genetic perturbations, when combined, result in a phenotype that does not appear to be merely explained by the superimposition or addition of effects of the original perturbations. ab (not=) E""" ; mi:isDefinedBy "A genetic interaction refers to an unexpected phenotype not easily explained by combining the effects of individual genetic variants (7).", "A quantitative genetic interaction definition has two components: a quantitative phenotypic measure and a neutrality function that predicts the phenotype of an organism carrying two noninteracting mutations. Interaction is then defined by deviation of a double-mutant organism's phenotype from the expected neutral phenotype.", "More generally, a genetic interaction can be defined as the difference between an experimentally measured double-mutant phenotype and an expected double-mutant phenotype, the latter of which is predicted from the combination of the single-mutant effects, assuming the mutations act independently.", "Two genes A and B 'genetically interact' when the phenotype generated as the result of mutations in both genes (double mutant ab) is unexpectedly not just a combination of the phenotypes of the two single mutants a and b." ; oboInOwl:hasExactSynonym "Fisher epistasis" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0208" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "genetic interaction (sensu unexpected)" ; rdfs:subClassOf obo:MI_2402 . obo:MI_0209 obo:IAO_0000115 "Attachment of one or two 20-carbon lipophilic geranylgeranyl isoprene units from geranylgeranyl diphosphate to one or more cysteine residue(s).Reversible reaction that can affect C residue." ; oboInOwl:hasExactSynonym "geranylgeranylation" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0209" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "geranylgeranylation reaction" ; rdfs:subClassOf obo:MI_0211 . obo:MI_0210 obo:IAO_0000115 "Irreversible introduction of a hydroxyl group that can affect K,P,Y or R residues. Hydroxylation is the first step in the oxidative degeneration of organic compounds." ; oboInOwl:hasExactSynonym "hydroxylation" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0210" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "hydroxylation reaction" ; rdfs:subClassOf obo:MI_0414 . obo:MI_0211 obo:IAO_0000115 "Covalent or non covalent binding of lipid group on a protein residue." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0211" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "lipid addition" ; rdfs:subClassOf obo:MI_0414 . obo:MI_0212 obo:IAO_0000115 "Cleavage of a lipid group covalently bound to a protein residue." ; oboInOwl:hasExactSynonym "lipid cleavage" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0212" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "lipoprotein cleavage reaction" ; rdfs:subClassOf obo:MI_0194 . obo:MI_0213 obo:IAO_0000115 "The covalent attachment of a methyl residue to one or more monomeric units in a polypeptide, polynucleotide, polysaccharide, or other biological polymer. Irreversible reaction that can affect A,G,M,F,P,C,R,N,Q,E,H,or K residues." ; oboInOwl:hasExactSynonym "methylation" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0213" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "methylation reaction" ; rdfs:subClassOf obo:MI_0414 . obo:MI_0214 obo:IAO_0000115 "Irreversible covalent addition of a myristoyl group via an amide bond to the alpha-amino group of an amino acid. Reaction that can affect K or G residues." ; oboInOwl:hasExactSynonym "myristoylation" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0214" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "myristoylation reaction" ; rdfs:subClassOf obo:MI_0211 . obo:MI_0215 obo:IAO_0000115 """Interaction mediated by non-covalent, weak forces rearrangement. OBSOLETE use physical interaction (MI:0218) instead.""" ; oboInOwl:hasExactSynonym "non covalent inter" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0215" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "non covalent interaction" ; owl:deprecated true . obo:MI_0216 obo:IAO_0000115 "Covalent attachment of palmitic acid to the cysteine residues of membrane proteins. Reversible reaction that can affect C,K,T or S residues." ; oboInOwl:hasExactSynonym "palmitoylation" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0216" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "palmitoylation reaction" ; rdfs:subClassOf obo:MI_0211 . obo:MI_0217 obo:IAO_0000115 "Reversible reaction that can affect D,C,H,S,T,Y,R residues." ; oboInOwl:hasExactSynonym "phosphorylation" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0217" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "phosphorylation reaction" ; rdfs:subClassOf obo:MI_0414 . obo:MI_0218 obo:IAO_0000115 """Interaction among molecules that can be direct or indirect. OBSOLETE: splitted to 'association' MI:0914 and 'physical association' MI:0915. For remapping consider the experimental setting of an interaction. For bulk remapping a possible criteria is to whatever physical interaction that has among its participant a bait should become 'association' MI:0914 the others can become 'physical association' MI:0915. Two hybrid interactions are an expection and can be 'physical association' MI:0915.""" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0218" ; a owl:Class ; rdfs:label "physical interaction" ; owl:deprecated true . obo:MI_0219 obo:IAO_0000115 """Death phenotype observed on cells carrying combination of two independently silent mutations. OBSOLETE: remap to CV intraction type 'synthetic interaction' MI:0794 and external CV for phenotype description (lethal FBcv:0000351)""" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0219" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "synthetic lethal" ; owl:deprecated true . obo:MI_0220 obo:IAO_0000115 "Reversible reaction that create a covalent bond between a C-terminus G of ubiquitin and a K residue of the target." ; oboInOwl:hasExactSynonym "ubiquitination" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0220" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "ubiquitination reaction" ; rdfs:subClassOf obo:MI_0414 . obo:MI_0221 obo:IAO_0000115 "Synthesis rate of a molecule under investigation described in comparison with its naturally occurring expression level in a cell." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0221" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "expression level" ; rdfs:subClassOf obo:MI_0346 . obo:MI_0222 obo:IAO_0000115 "A molecule whose synthesis is under control of its natural gene promoter or estimated to be expressed at a similar rate." ; oboInOwl:hasExactSynonym "endogenous", "endogenous level" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0222" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "physiological level" ; rdfs:subClassOf obo:MI_0221 . obo:MI_0223 obo:IAO_0000115 "A molecule is estimated to be expressed at lower levels than in physiological condition." ; oboInOwl:hasExactSynonym "under-expressed" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0223" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "under expressed level" ; rdfs:subClassOf obo:MI_0221, obo:MI_0803 . obo:MI_0225 obo:IAO_0000115 "The method combines a modified chromatin immunoprecipitation (ChIP) procedure, with DNA microarray analysis. Cells are fixed with formaldehyde, harvested, and disrupted by sonication. The DNA fragments cross-linked to a protein of interest are enriched by immunoprecipitation with a specific antibody. After reversal of the cross-links, the enriched DNA is amplified and labeled with a fluorescent dye (Cy5) by using a ligation-mediatedpolymerase chain reaction (LM-PCR). In parallel a sample of DNA that is not enriched by immunoprecipitation is subjected to LM-PCR in the presence of a different fluorophore (Cy3), and both immunoprecipitation (IP)-enriched and unenriched pools of labeled DNA were hybridized to a single DNA microarray containing a set of intergenic sequences. The ratio of the Cy5 to Cy3 fluorescence intensities measured at each DNA element in the microarray provided a measure of the extent of binding of the transcription factor to the corresponding genomic locus." ; oboInOwl:hasExactSynonym "chip-chip" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0225" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "chromatin immunoprecipitation array" ; rdfs:subClassOf obo:MI_0008, obo:MI_0402 . obo:MI_0226 obo:IAO_0000115 "Stable complexes and their component proteins can be separated on the basis of their net charge by ion-exchange chromatography. If a protein has a net positive charge at pH 7, it will usually bind to a column of beads containing carboxylate groups, and can then be eluted by increasing the concentration of sodium chloride or another salt in the eluting buffer by competition of sodium ions with positively charged groups on the protein for binding to the column. Protein that have a low density of net positive charge will tend to emerge first, followed by those having a higher charge density. Positively charged complexes or proteins (cationic proteins) can be separated on negatively charged carboxymethyl-cellulose (CM-cellulose) columns. Conversely, negatively charged complexes or proteins (anionic proteins) can be separated by chromatography on positively charged diethylaminoethyl-cellulose (DEAE-cellulose) columns." ; oboInOwl:hasExactSynonym "IEC", "ion exchange chrom" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0226" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "ion exchange chromatography" ; rdfs:subClassOf obo:MI_0091 . obo:MI_0227 obo:IAO_0000115 "Reverse phase chromatography operates on the basis of hydrophilicity and lipophilicity. The stationary phase consists of silica based packings with n-alkyl chains covalently bound. For example, C-8 signifies an octyl chain and C-18 an octadecyl ligand in the matrix. The more hydrophobic the matrix on each ligand, the greater is the tendency of the column to retain hydrophobic moieties. Thus hydrophilic compounds elute more quickly than do hydrophobic compounds." ; oboInOwl:hasExactSynonym "reverse phase chrom" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0227" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "reverse phase chromatography" ; rdfs:subClassOf obo:MI_0091 . obo:MI_0228 obo:IAO_0000115 "Protein complementation assay performed by dissecting a cytoplasmic protein activity and restoring it through the two hybrid proteins interaction. OBSOLETE remap to MI:0090 protein complementation assay" ; oboInOwl:hasExactSynonym "cytoplasmic compl" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0228" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "cytoplasmic complementation assay" ; owl:deprecated true . obo:MI_0229 obo:IAO_0000231 obo:IAO_0000227 ; obo:IAO_0100001 obo:MI_0809 ; a owl:Class ; owl:deprecated true . obo:MI_0230 obo:IAO_0000115 "OBSOLETE remap to MI:0090 protein complementation assay." ; oboInOwl:hasExactSynonym "membrane compl" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0230" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "membrane bound complementation assay" ; owl:deprecated true . obo:MI_0231 obo:IAO_0000115 "The MAPPIT(mammalian protein-protein interaction Trap) is a screening method for protein-protein interaction in mammalian cells, based on the reconstitution of a membrane STAT (signal transducers and activators of transcription) receptor. The bait protein is fused to a STAT recruitment-deficient receptor and the prey protein to a functional STAT recruitment sites. In such a configuration, a given baitprey interaction restores a STAT-dependent responses leading to the expression of a reporter gene. This system, enable to demonstrate not only protein interaction but also modification-independent and tyrosine phosphorylation- dependent interactions." ; oboInOwl:hasExactSynonym "mappit" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0231" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "mammalian protein protein interaction trap" ; rdfs:subClassOf obo:MI_0090 . obo:MI_0232 obo:IAO_0000115 "Protein complementation assay performed by dissecting a transcription factor activity (DNA binding domain and transcription activation domain) its restoration through the two hybrid proteins interaction that lead to a reporter gene expression." ; oboInOwl:hasExactSynonym "transcription compl" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0232" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "transcriptional complementation assay" ; rdfs:subClassOf obo:MI_0090 . obo:MI_0233 obo:IAO_0000115 "A stable set of interacting protein and DNA that can be copurified and operate as a functional unit." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0233" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "protein dna complex" ; rdfs:subClassOf obo:MI_1299 . obo:MI_0234 obo:IAO_0000115 "Molecule labelled with 131 radio isotope of iodine atoms." ; oboInOwl:hasExactSynonym "131I", "I131" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0234" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "131i radiolabel" ; rdfs:subClassOf obo:MI_0517 . obo:MI_0235 obo:IAO_0000115 "Molecule labelled with the radio isotope 14 of carbon atoms." ; oboInOwl:hasExactSynonym "14C", "C14" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0235" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "14c radiolabel" ; rdfs:subClassOf obo:MI_0517 . obo:MI_0236 obo:IAO_0000115 "Molecule labelled with the radio isotope 32 of phosphorus atoms." ; oboInOwl:hasExactSynonym "32P", "P32" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0236" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "32p radiolabel" ; rdfs:subClassOf obo:MI_0517 . obo:MI_0237 obo:IAO_0000115 "Molecule labelled with the radio isotope 33 of phosphorus atoms." ; oboInOwl:hasExactSynonym "33P", "P33" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0237" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "33p radiolabel" ; rdfs:subClassOf obo:MI_0517 . obo:MI_0238 obo:IAO_0000115 "Molecules labelled with isotope 3 of hydrogen atoms." ; oboInOwl:hasExactSynonym "3H", "H3", "tritium" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0238" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "3h radiolabel" ; rdfs:subClassOf obo:MI_0517 . obo:MI_0239 obo:IAO_0000115 "Biotin, a 244 Dalton vitamin found in tissue and blood, binds with high affinity to avidin and streptavidin protein. Since biotin is a relatively small molecule, it can be conjugated to many proteins or nucleic acids without significantly altering their biological activity. Biotinylation reagents are available for targeting a variety of specific functional groups, including primary amines, sulfhydryls, carboxyls and carbohydrates that lead to nucleotides or amino acid biotinilation." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0239" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "biotin tag" ; rdfs:subClassOf obo:MI_0507 . obo:MI_0240 obo:IAO_0000115 "The protein under study is expressed as a fusion with a labelling protein, having either fluorescence properties or an enzymatic activity that facilitates its purification, identification, localisation or quantification." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0240" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "fusion protein" ; rdfs:subClassOf obo:MI_0507 . obo:MI_0241 obo:IAO_0000115 "Protein is fused to horseradish peroxidase, and the measure of this enzyme activity can be taken as indicative of presence of protein." ; oboInOwl:hasExactSynonym "hrp tag" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0241" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "horseradish peroxidase tag" ; rdfs:subClassOf obo:MI_0365 . obo:MI_0242 obo:IAO_0000115 "This qualifier is used when the crossreference is imported from the Gene Ontology tag definition_reference." ; oboInOwl:hasExactSynonym "go-definition-ref" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0242" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "gene ontology definition reference" ; rdfs:subClassOf obo:MI_0353 . obo:MI_0243 obo:IAO_0000115 "Reference to the master sequence from which this isoform has been derived." ; oboInOwl:hasExactSynonym "isoform-parent" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0243" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "isoform parent sequence reference" ; rdfs:subClassOf obo:MI_0353 . obo:MI_0244 obo:IAO_0000115 """Collection of functional complexes within Reactome - a knowledgebase of biological processes. http://www.reactome.org/. OSOLETE - this concept no longer exists within Reactome.""" ; oboInOwl:hasDbXref "id-validation-regexp:", "search-url:" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0244" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "reactome complex" ; owl:deprecated true . obo:MI_0245 obo:IAO_0000115 """Collection of protein within the Reactome database - a knowledgebase of biological processes. http://www.reactome.org/. OBSOLETE - this concept no longer exists within Reactome.""" ; oboInOwl:hasDbXref "id-validation-regexp:", "search-url:" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0245" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "reactome protein" ; owl:deprecated true . obo:MI_0246 obo:IAO_0000115 """CABRI cell lines catalogue available at. http://www.cabri.org/""" ; oboInOwl:hasDbXref "id-validation-regexp:", "search-url:" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0246" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "cabri" ; rdfs:subClassOf obo:MI_0473 . obo:MI_0247 obo:IAO_0000115 """New EBI Web Taxonomy. http://www.ebi.ac.uk/newt OBSOLETE: Consider remapping to uniprot taxonomy MI:0942""" ; oboInOwl:hasDbXref "id-validation-regexp:", "search-url:" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0247" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "newt" ; owl:deprecated true . obo:MI_0248 obo:IAO_0000115 """The RESID Database of Protein Modifications is a comprehensive collection of annotations and structures for protein modifications including amino-terminal, carboxyl-terminal and peptide chain cross-link post-translational modifications. http://www.ebi.ac.uk/RESID/index.html""" ; oboInOwl:hasDbXref "id-validation-regexp:", "search-url:" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0248" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "resid" ; rdfs:subClassOf obo:MI_0447 . obo:MI_0249 obo:IAO_0000115 """A Database of Human Unidentified Gene-Encoded Large Proteins Analyzed by Kazusa Human cDNA Project. http://www.kazusa.or.jp/huge/""" ; oboInOwl:hasDbXref "id-validation-regexp:", "search-url:" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0249" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "huge" ; rdfs:subClassOf obo:MI_0683 . obo:MI_0250 obo:IAO_0000115 "A genomic region (or regions) that includes all of the sequence elements necessary to encode a functional transcript. A gene may include regulatory regions, transcribed regions and/or other functional sequence regions." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0250" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "gene" ; rdfs:subClassOf obo:MI_0313 . obo:MI_0251 obo:IAO_0000115 "Reference of a protein object pointing to its genomic or nucleic acid sequence." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0251" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "gene product" ; rdfs:subClassOf obo:MI_0353 . obo:MI_0252 obo:IAO_0000115 "Property of a subsequence that may be involved with or interfere with the binding of a molecule and are supported by experimental evidences." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0252" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "biological feature" ; rdfs:subClassOf obo:MI_0116 . obo:MI_0253 obo:IAO_0000115 "One of several nuclides having the same number of protons in their nuclei and hence having the same atomic number, but differing in the number of neutrons and therefore, in the mass number." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0253" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "isotope label" ; rdfs:subClassOf obo:MI_0505 . obo:MI_0254 obo:IAO_0000115 "This term refers to methods that aim at interfering with the activity of a specific gene by altering the gene regulatory or coding sequences. This goal can be achieved either by a classical genetic approach (random mutagenesis followed by phenotype characterization and genetic mapping) or by a reverse genetics approach where a gene of interest is modified by directed mutagenesis." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0254" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "genetic interference" ; rdfs:subClassOf obo:MI_0045 . obo:MI_0255 obo:IAO_0000115 "This term refers to methods designed to interfere with gene expression at post-transcriptional level rather than with the gene itself." ; oboInOwl:hasExactSynonym "expression interfer" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0255" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "post transcriptional interference" ; rdfs:subClassOf obo:MI_0045 . obo:MI_0256 obo:IAO_0000115 "RNA interference (RNAi) is a post-transcriptional gene silencing method reproducing a naturally occurring phenomena. RNAi is the process whereby double-stranded RNA (dsRNA) induces the sequence-specific degradation of homologous mRNA. RNAi or dsRNA-induced silencing phenomena are present in evolutionarily diverse organisms, e.g., nematodes, plants, fungi, and trypanosomes. The mechanisms by which RNAi works is initiated by a progressive cleavage of dsRNA into 21 to 23 nucleotide (nt) short interfering RNAs (siRNAs). These native siRNA duplexes are then incorporated into a protein complex called RNA-induced silencing complex (RISC). ATP-dependent unwinding of the siRNA duplex generates an active RISC complex. Guided by the antisense strand of siRNA, the active RISC complex recognizes and cleaves the corresponding mRNA." ; oboInOwl:hasExactSynonym "rnai" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0256" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "rna interference" ; rdfs:subClassOf obo:MI_0255 . obo:MI_0257 obo:IAO_0000115 "This approach is based on the observation that expression of RNA that is complementary to a specific mRNA can decrease the synthesis of its gene product either by increasing the degradation of the targeted mRNA or by interfering with its translation." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0257" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "antisense rna" ; rdfs:subClassOf obo:MI_0255 . obo:MI_0258 obo:IAO_0000115 """Intracellular or extracellular expression of antibodies is used to target specific gene products in order to inactivate them. Most of the times the antibody scaffold need s to reengineered for efficient expression and solubility in the cytoplasm. OBSOLETE as such method can be described using the biological role inhibitor (MI:0586).""" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0258" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "inhibitor antibodies" ; owl:deprecated true . obo:MI_0259 obo:IAO_0000115 """This approach is based on the expression of peptides that bind to specific target proteins thereby interfering with their activity. In a standard approach the interfering peptide is expressed by genetic fusion to a stable protein scaffold. Interfering peptides can also be introduced into cells by fusing them to proteins or peptides (homeodomains, Tat protein.) having the property of penetrating the cell membrane. The peptide-carrier fusion protein is either synthesized chemically or produced in vivo, normally in bacteria. When the purified fusion protein is added to a cell culture, it penetrates the cell membrane thereby permitting the fused peptide to interfere with its target protein. OBSOLETE as such method can be described using the biological role inhibitor (MI:0586).""" ; oboInOwl:hasExactSynonym "perturbagens pep" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0259" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "perturbagens peptides" ; owl:deprecated true . obo:MI_0260 obo:IAO_0000115 """Protein activity is inhibited by small inorganic molecules (drugs) that specifically bind to their targets. Recently this classical pharmacological approach is sometime referred to as 'chemical genetics'. OBSOLETE as such method can be described using the biological role inhibitor (MI:0586).""" ; oboInOwl:hasExactSynonym "inhibitor small mol" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0260" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "inhibitor small molecules" ; owl:deprecated true . obo:MI_0261 obo:IAO_0000115 """A supressed gene mutation cause of an altered phenotype that is reverted to wild type phenotype when cell also carry a suppressor gene with a specific mutation or altered expression level. OBSOLETE: remap to CV intraction type 'suppressive interaction' MI:0793.""" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0261" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "obsolete suppression" ; owl:deprecated true . obo:MI_0262 obo:IAO_0000115 """A given (suppressed) mutation phenotype is reverted by a supressor gene mutation. OBSOLETE: remap to CV intraction type 'suppressive interaction' MI:0793 and genetic experimental form 'mutated gene' MI:0804. """ ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0262" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "suppression mutation" ; owl:deprecated true . obo:MI_0263 obo:IAO_0000115 """Knocked out gene is the suppressor of a phenotype. OBSOLETE: remap to CV intraction type 'suppressive interaction' MI:0793 and genetic experimental form 'knock out' MI:0788. """ ; oboInOwl:hasExactSynonym "suppress knockout" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0263" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "suppression knockout" ; owl:deprecated true . obo:MI_0264 obo:IAO_0000115 """A mutation is the partial suppressor of a mutant phenotype. OBSOLETE: remap to CV intraction type 'suppressive interaction' MI:0793 and genetic experimental form 'knock down' MI:0789. """ ; oboInOwl:hasExactSynonym "suppression partial" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0264" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "suppression partial alteration" ; owl:deprecated true . obo:MI_0265 obo:IAO_0000115 """An altered expression is the suppressor of a phenotype. OBSOLETE: remap to CV intraction type 'suppressive interaction' MI:0793 and genetic experimental form 'expression level alteration' MI:0803. """ ; oboInOwl:hasExactSynonym "suppress expression" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0265" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "suppression expression alteration" ; owl:deprecated true . obo:MI_0266 obo:IAO_0000115 """Overexpression is the suppressor of a phenotype. OBSOLETE: remap to CV intraction type 'suppressive interaction' MI:0793 and genetic experimental form 'over expressed' MI:0506. """ ; oboInOwl:hasExactSynonym "suppress overexpress" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0266" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "suppression overexpression" ; owl:deprecated true . obo:MI_0267 obo:IAO_0000115 """Level of over/underexpression scales the 'extend' of a phenotype. OBSOLETE: remap to CV intraction type 'suppressive interaction' MI:0793 and genetic experimental form 'expression level alteration' MI:0803. """ ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0267" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "suppression scalable" ; owl:deprecated true . obo:MI_0268 obo:IAO_0000115 """Underexpression is the suppressor of a phenotype. OBSOLETE: remap to CV intraction type 'suppressive interaction' MI:0793 and genetic experimental form 'under expressed' MI:0223. """ ; oboInOwl:hasExactSynonym "suppress underexpres" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0268" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "suppression underexpression" ; owl:deprecated true . obo:MI_0269 obo:IAO_0000115 """Two silent mutations show an altered phenotype when they co-occur on the same cell. OBSOLETE: remap to CV intraction type 'synthetic interaction' MI:0794.""" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0269" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "synthetic phenotype" ; owl:deprecated true . obo:MI_0270 obo:IAO_0000115 """Two silent mutations show a conditional synthetic lethal phenotype when they co-occur on the same cell. OBSOLETE: remap to CV intraction type 'synthetic interaction' MI:0794 and external CV for phenotype description (lethal FBcv:0000351)""" ; oboInOwl:hasExactSynonym "cond syntetic lethal" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0270" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "conditional synthetic lethal" ; owl:deprecated true . obo:MI_0271 obo:IAO_0000115 """Two silent mutations show a temperature sensitive lethal phenotype when they co-occur on the same cell. OBSOLETE: remap to CV intraction type 'synthetic interaction' MI:0794 and external CV for phenotype description (FBcv:0000310 'temperature conditional')""" ; oboInOwl:hasExactSynonym "temprtr synt lethal" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0271" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "conditional synthetic lethal temperature-sensitivity" ; owl:deprecated true . obo:MI_0273 obo:IAO_0000115 """Two silent mutations show altered growth effect when they co-occur on the same cell. OBSOLETE: remap to CV intraction type 'synthetic interaction' MI:0794 and external CV for phenotype description ( FBcv:0000427 'cell growth defective')""" ; oboInOwl:hasExactSynonym "synt growth effect" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0273" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "synthetic growth effect" ; owl:deprecated true . obo:MI_0274 obo:IAO_0000115 """Two silent mutations show growth defect when they co-occur on the same cell. OBSOLETE: remap to CV intraction type 'synthetic interaction' MI:0794 and external CV for phenotype description ( FBcv:0000427 'cell growth defective')""" ; oboInOwl:hasExactSynonym "synt growth defect" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0274" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "synthetic growth defect" ; owl:deprecated true . obo:MI_0275 obo:IAO_0000115 """Two silent mutations show growth increase when they co-occur on the same cell. OBSOLETE: remap to CV intraction type 'synthetic interaction' MI:0794 and external CV for phenotype description ( FBcv:0000427 'cell growth defective')""" ; oboInOwl:hasExactSynonym "synt growth increase" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0275" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "synthetic growth increase" ; owl:deprecated true . obo:MI_0276 obo:IAO_0000115 "Blue native PAGE (BN-PAGE) permits a high-resolution separation of multi-protein complexes under native conditions. Blue native (BN)-PAGE is a charge shift method, in which the electrophoretic mobility of a complex is determined by the negative charge of the bound Coomassie dye and the size and shape of the complex. Coomassie does not act as a detergent and preserves the structure of complexes. Importantly, the resolution of BN-PAGE is much higher than that of other methods such as gel filtration or sucrose-gradient ultracentrifugation. Combined with other pre-purifications or dialysis steps this method permits the analysis of multi-protein complexes of whole cellular lysates by BN-PAGE." ; oboInOwl:hasExactSynonym "bn-page" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0276" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "blue native page" ; rdfs:subClassOf obo:MI_0404 . obo:MI_0300 obo:IAO_0000115 "Descriptor of type of nomenclature used to describe interactor." ; oboInOwl:hasExactSynonym "CvAliasType" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0300" ; oboInOwl:inSubset mi:Drugable, mi:PSI-MI_slim ; a owl:Class ; rdfs:label "alias type" ; rdfs:subClassOf obo:MI_0000 . obo:MI_0301 obo:IAO_0000115 "Gene name." ; oboInOwl:hasExactSynonym "gene" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0301" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "gene name" ; rdfs:subClassOf obo:MI_1041 . obo:MI_0302 obo:IAO_0000115 "Gene name synonym." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0302" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "gene name synonym" ; rdfs:subClassOf obo:MI_1041 . obo:MI_0303 obo:IAO_0000115 "Synonym as used in Gene Ontology." ; oboInOwl:hasExactSynonym "go synonym" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0303" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "gene ontology synonym" ; rdfs:subClassOf obo:MI_1041 . obo:MI_0304 obo:IAO_0000115 "Isoform synonym." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0304" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "isoform synonym" ; rdfs:subClassOf obo:MI_1041 . obo:MI_0305 obo:IAO_0000115 "A name used to represent an ORF in a completely sequenced genome or chromosome. It is generally based on a prefix representing the organism and a number which usually represents the sequential ordering of genes on the chromosome. Depending on the genome sequencing center, numbers are attributed only to protein-coding genes, or also to pseudogenes, or also to tRNAs and other features." ; oboInOwl:hasExactSynonym "CDS number", "ONL", "ORF number", "Ordered locus name", "locus name", "systematic gene number" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0305" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:comment "For instance HI0934, Rv3245c, At5g34500, YER456W." ; rdfs:label "ordered locus name" ; rdfs:subClassOf obo:MI_1041 . obo:MI_0306 obo:IAO_0000115 "A name temporarily attributed by a sequencing project to an open reading frame. This name is generally based on a cosmid numbering system." ; oboInOwl:hasExactSynonym "orf name" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0306" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:comment "For instance MtCY277-28c, SYGP-ORF50, SpBC2F12-04, C06E1, CG10954. Also called Sequencing names or Contig names or Temporary ORFNames." ; rdfs:label "open reading frame name" ; rdfs:subClassOf obo:MI_1041 . obo:MI_0307 obo:IAO_0000115 "Method by which molecule is delivered or engineered into a cell." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0307" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "delivery method" ; rdfs:subClassOf obo:MI_0346 . obo:MI_0308 obo:IAO_0000115 "Method for temporarily permeabilising cell membranes so as to facilitate the entry of large or hydrophilic molecules (as in transfection). A brief (ca 1 msec) electric pulse is given with potential gradients of about 700V/cm." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0308" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "electroporation" ; rdfs:subClassOf obo:MI_0307 . obo:MI_0309 obo:IAO_0000115 """A cassette coding for a protein tag is inserted by homologous recombination onto the genomic copy of an open reading frame. The advantage of this delivery method is that the resulting engineered protein is expressed under its natural promoter control. OBSOLETE redundant term. Map to feature type : tag (MI:0507).""" ; oboInOwl:hasExactSynonym "genetic tag insertion" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0309" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "genomic tagging" ; owl:deprecated true . obo:MI_0310 obo:IAO_0000115 "Molecule introduced into a cell via an external organism, usually a virus or bacteria." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0310" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "infection" ; rdfs:subClassOf obo:MI_0307 . obo:MI_0311 obo:IAO_0000115 "The insertion of a substance into a cell through a microneedle. To extrude the substances through the very fine needle tip, either hydrostatic pressure (pressure injection) or electric currents (ionophoresis) is employed." ; oboInOwl:hasExactSynonym "micro-injection" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0311" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "microinjection" ; rdfs:subClassOf obo:MI_0307 . obo:MI_0312 obo:IAO_0000115 "Introducing DNA into eukaryotic cells, such as animal cells, is called transfection. Transfection typically involves opening transient \"holes\" or gates in cells to allow the entry of extracellular molecules, typically supercoiled plasmid DNA, but also siRNA, among others. Transfection differs from transformation since the DNA is not generally incorporated into the cell's genome, it is only transiently expressed." ; oboInOwl:hasExactSynonym "nucl transfection" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0312" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "nucleic acid transfection" ; rdfs:subClassOf obo:MI_0704 . obo:MI_0313 obo:IAO_0000115 "Molecular species involved in the interaction." ; oboInOwl:hasExactSynonym "participant type" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0313" ; oboInOwl:inSubset mi:Drugable, mi:PSI-MI_slim ; a owl:Class ; rdfs:label "interactor type" ; rdfs:subClassOf obo:MI_0000 . obo:MI_0314 obo:IAO_0000115 "Set of interacting molecules that can be copurified. This term and its children should be use only at PARTICIPANT level." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0314" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "complex" ; rdfs:subClassOf obo:MI_0313 . obo:MI_0315 obo:IAO_0000115 "A stable set of interacting proteins that can be copurified and operate as a functional unit." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0315" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "protein complex" ; rdfs:subClassOf obo:MI_1299 . obo:MI_0316 obo:IAO_0000115 "A macromolecular complex containing both protein and RNA molecules." ; oboInOwl:hasExactSynonym "protein rna complex", "ribonucleoprot compl" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0316" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "ribonucleoprotein complex" ; rdfs:subClassOf obo:MI_1299 . obo:MI_0317 obo:IAO_0000115 "Previously described interaction now being used as an interactor to describe hierarchical build-up of complexes." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0317" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "interaction" ; rdfs:subClassOf obo:MI_0313 . obo:MI_0318 obo:IAO_0000115 "Linear polymers of nucleotides, linked by 3',5' phosphodiester linkages." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0318" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "nucleic acid" ; rdfs:subClassOf obo:MI_0383 . obo:MI_0319 obo:IAO_0000115 "Polymer formed by the deoxyribose sugar group, and the nucleotides bases adenine, guanine, thymine and cytosine." ; oboInOwl:hasExactSynonym "DNA", "deoxyribonucleic acid", "dna" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0319" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "deoxyribonucleic acid" ; rdfs:subClassOf obo:MI_0318 . obo:MI_0320 obo:IAO_0000115 "Polymer formed by ribose sugar group, and the bases of the nucleotides adenine, guanine, uracil and cytosine." ; oboInOwl:hasExactSynonym "RNA", "rna" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0320" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "ribonucleic acid" ; rdfs:subClassOf obo:MI_0318 . obo:MI_0321 obo:IAO_0000115 "Species of RNA that catalyses cleavage or trans-esterification of the phosphodiester link." ; oboInOwl:hasExactSynonym "catalytic RNA", "catalytic ribonucleic acid", "crna" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0321" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "catalytic rna" ; rdfs:subClassOf obo:MI_0320 . obo:MI_0322 obo:IAO_0000115 "Small RNA molecules that hybridize to specific mRNAs and direct their RNA editing." ; oboInOwl:hasExactSynonym "grna", "guide RNA" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0322" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "guide rna" ; rdfs:subClassOf obo:MI_0320 . obo:MI_0323 obo:IAO_0000115 "A heterogeneous mixture of RNA molecules with a rapid turnover rate that occurs in cell nuclei during protein synthesis; it is the form of RNA synthesized in eukaryotes by RNA polymerase II, which is translated into protein." ; oboInOwl:hasExactSynonym "heterogeneous nuclear RNA", "heterogeneous nuclear ribonucleic acid", "hnrna" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0323" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "heterogeneous nuclear rna" ; rdfs:subClassOf obo:MI_0320 . obo:MI_0324 obo:IAO_0000115 "Single-stranded RNA molecule that specifies the amino acid sequence of one or more polypeptide chains." ; oboInOwl:hasExactSynonym "mRNA", "mrna" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0324" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "messenger rna" ; rdfs:subClassOf obo:MI_0320 . obo:MI_0325 obo:IAO_0000115 "The low molecular weight RNAs that specifically bind amino acids by aminoacetylation to form aminoacyl tRNA and which possess a special nucleotide triplet, the anticodon." ; oboInOwl:hasExactSynonym "tRNA", "transfer RNA", "transfer ribonucleic acid", "trna" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0325" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "transfer rna" ; rdfs:subClassOf obo:MI_0320 . obo:MI_0326 obo:IAO_0000115 "A linear polymer of amino acids joined by peptide bonds in a specific sequence." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0326" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "protein" ; rdfs:subClassOf obo:MI_0383 . obo:MI_0327 obo:IAO_0000115 "Chains of amino acids joined by peptide bonds. Distinction between peptides, oligopeptides and polypeptides is arbitrarily by length; a polypeptide is perhaps more than 15 residues." ; oboInOwl:hasExactSynonym "oligopeptide", "polypeptide" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0327" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "peptide" ; rdfs:subClassOf obo:MI_0383 . obo:MI_0328 obo:IAO_0000115 "Molecule not part of or directly encoded by the genome, encompasses any constitutionally or isotopically distinct atom, molecule, ion, ion pair, radical, radical ion, complex, conformer, etc., identifiable as a separately distinguishable entity." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0328" ; oboInOwl:inSubset mi:Drugable, mi:PSI-MI_slim ; a owl:Class ; rdfs:label "small molecule" ; rdfs:subClassOf obo:MI_1100 . obo:MI_0329 obo:IAO_0000115 "Any type of molecule, including complexes, that may be observed but not identified. This term should be use only at PARTICIPANT level." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0329" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "unknown participant" ; rdfs:subClassOf obo:MI_0313 . obo:MI_0330 obo:IAO_0000115 "Defines whether molecule is endogenously expressed or has in any way been altered, in sequence or expression level, from its native state. For a complete description of the experimental molecule form use the orthogonal CVs expression level, delivery method, and sample process." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0330" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "molecular source" ; rdfs:subClassOf obo:MI_0346 . obo:MI_0331 obo:IAO_0000115 "Molecule has been added into system from an external source or altered within the cell." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0331" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "engineered" ; rdfs:subClassOf obo:MI_0330 . obo:MI_0332 obo:IAO_0000115 "Unaltered endogenous molecule in its naturally occurring state." ; oboInOwl:hasExactSynonym "endogenous" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0332" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "naturally occurring" ; rdfs:subClassOf obo:MI_0330 . obo:MI_0333 obo:IAO_0000115 "Describes sequence positions resolution of a given participant feature. In PSI schema this CV is associated with the start and end position of a feature range." ; oboInOwl:hasExactSynonym "CvFuzzyType", "endStatus", "startStatus" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0333" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "feature range status" ; rdfs:subClassOf obo:MI_0000 . obo:MI_0334 obo:IAO_0000115 "Term describing the last amino acid of a peptide chain." ; oboInOwl:hasExactSynonym "c-term", "c-terminal", "c-terminus", "carboxy-terminus" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0334" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:comment "Displayed as 'c'." ; rdfs:label "c-terminal position" ; rdfs:subClassOf obo:MI_0333 . obo:MI_0335 obo:IAO_0000115 "Position within the sequence clearly defined." ; oboInOwl:hasExactSynonym "certain" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0335" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "certain sequence position" ; rdfs:subClassOf obo:MI_0333 . obo:MI_0336 obo:IAO_0000115 "Partially determined sequence position known to be in a location higher than a given position." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0336" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:comment "Displayed as '>'." ; rdfs:label "greater-than" ; rdfs:subClassOf obo:MI_0333 . obo:MI_0337 obo:IAO_0000115 "Partially determined sequence position known to be in a position lower than a given position." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0337" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:comment "Displayed as '<'." ; rdfs:label "less-than" ; rdfs:subClassOf obo:MI_0333 . obo:MI_0338 obo:IAO_0000115 "Describes a sequence position known to be in a certain range, where the exact position is unclear." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0338" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:comment "For instance when an amino acid modification is known to be in the region from 5 to 7. Displayed as '..'." ; rdfs:label "range" ; rdfs:subClassOf obo:MI_0333 . obo:MI_0339 obo:IAO_0000115 "Term describing a completely unknown or unspecified sequence position." ; oboInOwl:hasExactSynonym "undetermined" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0339" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:comment "Displayed as '?'." ; rdfs:label "undetermined sequence position" ; rdfs:subClassOf obo:MI_0333 . obo:MI_0340 obo:IAO_0000115 "Term describing the first amino acid of a peptide chain." ; oboInOwl:hasExactSynonym "amino-terminus", "n-term", "n-terminal ", "n-terminus" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0340" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:comment "Displayed as 'n'." ; rdfs:label "n-terminal position" ; rdfs:subClassOf obo:MI_0333 . obo:MI_0341 obo:IAO_0000115 "Mixture of protein forms where N-terminus has been progressively truncated." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0341" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "ragged n-terminus" ; rdfs:subClassOf obo:MI_0340 . obo:MI_0342 obo:IAO_0000115 "Indicates the sample context in which each interacting molecule is presented to its partner." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0342" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "sample process" ; rdfs:subClassOf obo:MI_0346 . obo:MI_0343 obo:IAO_0000115 "Mixed population of cDNAs (complementaryDNA) made from mRNA from a defined source, usually a specific cell type. This term should be associated only to nucleic acid interactors not to their proteins product. For instance in 2h screening use living cells (MI:0349) as sample process." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0343" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "cdna library" ; rdfs:subClassOf obo:MI_0342 . obo:MI_0344 obo:IAO_0000115 "Cell has been physically or chemically broken open and molecule present in resulting mixture of cellular components." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0344" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "cell lysate" ; rdfs:subClassOf obo:MI_0342 . obo:MI_0345 obo:IAO_0000115 "Name assigned to a molecule by the authors within a paper that may differ from the reference database." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0345" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "author assigned name" ; rdfs:subClassOf obo:MI_1041 . obo:MI_0346 obo:IAO_0000115 "Set of terms to describe the participant experimental treatment and status. This term groups a number of orthologous short controlled vocabularies delivery method, expression level, molecular source, and sample process. Each participant can then be annotated with a maximum of 4 terms selected from each short list." ; oboInOwl:hasExactSynonym "experimental prep" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0346" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "experimental preparation" ; rdfs:subClassOf obo:MI_0000 . obo:MI_0348 obo:IAO_0000115 "Cells has been fixed by treatment with organic solvent, staining and inclusion in a resin for microscopic analysis." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0348" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "fixed cell" ; rdfs:subClassOf obo:MI_0342 . obo:MI_0349 obo:IAO_0000115 "Molecule is observed within in a living cell." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0349" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "living cell" ; rdfs:subClassOf obo:MI_0342 . obo:MI_0350 obo:IAO_0000115 "Molecule has undergone one or more purification steps to isolate it from the cellular environment." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0350" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "purified" ; rdfs:subClassOf obo:MI_0342 . obo:MI_0351 obo:IAO_0000115 "The author states a molecule is completely pure, i.e. no other molecular species are present." ; oboInOwl:hasExactSynonym "pure" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0351" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "homogeneous" ; rdfs:subClassOf obo:MI_0350 . obo:MI_0352 obo:IAO_0000115 "The author states a molecule is only partially purified, i.e. other molecular species also known to be present." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0352" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "partially purified" ; rdfs:subClassOf obo:MI_0350 . obo:MI_0353 obo:IAO_0000115 "Qualifier to describe the type of information a cross-reference is pointing to." ; oboInOwl:hasExactSynonym "CvXrefQualifier", "refType", "xref type" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0353" ; oboInOwl:inSubset mi:Drugable, mi:PSI-MI_slim ; a owl:Class ; rdfs:label "cross-reference type" ; rdfs:subClassOf obo:MI_0000 . obo:MI_0354 obo:IAO_0000115 "Cross reference pointing to a Gene Ontology -'cellular component' term." ; oboInOwl:hasDbXref "search-url:" ; oboInOwl:hasExactSynonym "component", "go component term" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0354" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "cellular component" ; rdfs:subClassOf obo:MI_0353 . obo:MI_0355 obo:IAO_0000115 "Cross reference pointing to a Gene Ontology -'molecular function' term." ; oboInOwl:hasDbXref "search-url:" ; oboInOwl:hasExactSynonym "function", "go function term" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0355" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "molecular function" ; rdfs:subClassOf obo:MI_0353 . obo:MI_0356 obo:IAO_0000115 "Reference to the corresponding object in another database. Correspondence may be complete or partial." ; oboInOwl:hasExactSynonym "identity" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0356" ; oboInOwl:inSubset mi:Drugable, mi:PSI-MI_slim ; a owl:Class ; rdfs:comment "For instance this qualifier, in an interaction entry, can be associated to a cross reference to the same interaction in an other database." ; rdfs:label "identical object in an external resource" ; rdfs:subClassOf obo:MI_0353 . obo:MI_0357 obo:IAO_0000115 "Reference to a related paper which more fully describes either the experimental method or one or more of the interactors used within the experiment." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0357" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "method reference" ; rdfs:subClassOf obo:MI_0353 . obo:MI_0358 obo:IAO_0000115 "Used to indicate the PMID from which the experimental data is extracted." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0358" ; oboInOwl:inSubset mi:Drugable, mi:PSI-MI_slim ; a owl:Class ; rdfs:label "primary-reference" ; rdfs:subClassOf obo:MI_0353 . obo:MI_0359 obo:IAO_0000115 "Cross reference pointing to a Gene Ontology -'cellular process' term." ; oboInOwl:hasDbXref "search-url:" ; oboInOwl:hasExactSynonym "go process term", "process" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0359" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "biological process" ; rdfs:subClassOf obo:MI_0353 . obo:MI_0360 obo:IAO_0000115 "Reference to the corresponding object in another database (like identity xref qualifier) but the identifier used in the external database is a secondary identifier or former accession number." ; oboInOwl:hasExactSynonym "secondary-ac" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0360" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "secondary accession number" ; rdfs:subClassOf obo:MI_0353 . obo:MI_0361 obo:IAO_0000115 "Related object within the same database or pointing to an external database." ; oboInOwl:hasExactSynonym "see-also" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0361" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "additional information" ; rdfs:subClassOf obo:MI_0353 . obo:MI_0362 obo:IAO_0000115 "Evidence based on human assumption, either when the complete experimental support is not available or when the results are extended by homology to closely related orthologues sequences." ; oboInOwl:hasExactSynonym "modeled", "modelled" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0362" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "inference" ; rdfs:subClassOf obo:MI_0001, obo:MI_0002, obo:MI_0003 . obo:MI_0363 obo:IAO_0000115 "Evidence based on the author of a paper assumption, either when the complete experimental support is not available or when the results are extended by homology to closely related orthologues sequences." ; oboInOwl:hasExactSynonym "modeled by author", "modelled by author" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0363" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "inferred by author" ; rdfs:subClassOf obo:MI_0362 . obo:MI_0364 obo:IAO_0000115 "Evidence based on a curator assumption, either when the complete experimental support is not available or when the results are extended by homology to closely related orthologues sequences." ; oboInOwl:hasExactSynonym "modeled by curator", "modelled by curator" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0364" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "inferred by curator" ; rdfs:subClassOf obo:MI_0362 . obo:MI_0365 obo:IAO_0000115 "Molecule under study is fused to an enzyme, for example alkaline phosphatase, and measure of enzyme activity can be taken as indicative of presence of protein." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0365" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "enzyme tag" ; rdfs:subClassOf obo:MI_0240 . obo:MI_0366 obo:IAO_0000115 "Protein is fused to alkaline phosphatase, and the measure of this enzyme activity can be taken as indicative of presence of protein." ; oboInOwl:hasExactSynonym "alk phosphatase tag" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0366" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "alkaline phosphatase tag" ; rdfs:subClassOf obo:MI_0365 . obo:MI_0367 obo:IAO_0000115 "The green fluorescent protein of organisms such as the bioluminescent jellyfish Aequorea victoria can be fused to individual proteins which then acquire fluorescence excitation and emission spectra virtually identical to those of the native." ; oboInOwl:hasExactSynonym "GFP", "gfp tag", "green fluorescent protein" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0367" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "green fluorescent protein tag" ; rdfs:subClassOf obo:MI_0687 . obo:MI_0368 obo:IAO_0000115 "Yellow fluorescent protein from species such as Vibrio fischeri can be fused to individual proteins which then acquire fluorescence excitation and emission spectra virtually identical to those of the native." ; oboInOwl:hasExactSynonym "YFP", "yellow fluorescent protein", "yfp tag" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0368" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "yellow fluorescent protein tag" ; rdfs:subClassOf obo:MI_0687 . obo:MI_0369 obo:IAO_0000115 "The method is based on the repression of a reporter gene activity by two LexA DNA binding domains with different binding specificities. LexA is a transcription factor with an N-terminal DNA binding/activation domain (DBAct) and a C-terminal dimerization domain. LexA dimerization is required to repress transcription efficiently. The discovery of LexA DNA binding domains that bind to different DNA sequence enabled the development of this system." ; oboInOwl:hasExactSynonym "gallex" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0369" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "lex-a dimerization assay" ; rdfs:subClassOf obo:MI_0232 . obo:MI_0370 obo:IAO_0000115 "This assay allow identification of interactions in the inner membrane of E. coli. by using a chimeric construct ToxR-TM-MBP composed of the N-terminal DNA binding/transcriptional activation domain of ToxR (a dimerization dependant transcription factor) fused to a transmembrane domain of interest (TM) and a monomeric periplasmic anchor (the maltose binding protein). Association of the two TM results in the ToxR-mediated activation of a reporter gene such as CAT (chloroamphenicol acetyltransferase activity). The level of CAT expression indicates the strength of TM association. CAT expression can then be tested and quantify by measuring CAM resistance with disk diffusion assay or CAT activity assays on cell-free extracts." ; oboInOwl:hasExactSynonym "toxcat" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0370" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "tox-r dimerization assay" ; rdfs:subClassOf obo:MI_0090 . obo:MI_0371 obo:IAO_0000115 "Molecule labelled with 35 radio isotope of sulfur. Proteins are often metabolically labelled, usually be growth in 35S labelled culture medium." ; oboInOwl:hasExactSynonym "35S", "S35", "s35 radiolabelled" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0371" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "35s radiolabel" ; rdfs:subClassOf obo:MI_0517 . obo:MI_0372 obo:IAO_0000115 "Cell lysates are partially fractionated to isolate a specific subcellular fraction." ; oboInOwl:hasExactSynonym "subcellular prep" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0372" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "subcellular preparation" ; rdfs:subClassOf obo:MI_0344 . obo:MI_0373 obo:IAO_0000115 "Dye coupled to a molecule allowing its identification isolation and monitoring." ; oboInOwl:hasExactSynonym "dye labelled" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0373" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "dye label" ; rdfs:subClassOf obo:MI_0505 . obo:MI_0374 obo:IAO_0000115 "The organic polymethine cyanine dyes which, depending on structure, cover the spectrum from IR to UV.s. Their emission range is such that background fluorescence is often reduced. In addition these molecules can be linked directly to specific locations in synthetically produced nucleic acids." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0374" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "cyanine label" ; rdfs:subClassOf obo:MI_0373, obo:MI_0857 . obo:MI_0375 obo:IAO_0000115 "The organic cyanine Cy3 emits maximally at 570 nm." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0375" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "cy3 label" ; rdfs:subClassOf obo:MI_0374 . obo:MI_0376 obo:IAO_0000115 "The organic cyanine Cy5 emits maximally at 670 nm." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0376" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "cy5 label" ; rdfs:subClassOf obo:MI_0374 . obo:MI_0377 obo:IAO_0000115 "Fluorescein isothiocyanate is a yellow-green coloured low molecular weight dye which couples to proteins via reaction with primary amine groups at high pH. FITC is excitable at 488nm, close to its absorption maximum at 494nm, and produces maximum fluorescence emission around 520nm." ; oboInOwl:hasExactSynonym "FITC labelled", "fitc labelled", "fluorescein isothiocyanate labbeled" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0377" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "fluorescein isothiocyanate label" ; rdfs:subClassOf obo:MI_0939 . obo:MI_0378 obo:IAO_0000115 "Molecule can be labelled including rare isotopes among its constituent atoms that can be used to identify, localize or quantify the full molecule." ; oboInOwl:hasExactSynonym "rare isotope label" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0378" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "rare isotope label" ; rdfs:subClassOf obo:MI_0253 . obo:MI_0379 obo:IAO_0000115 "Molecules labelled with isotope 13 of carbon atoms." ; oboInOwl:hasExactSynonym "13C", "C13" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0379" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "13c label" ; rdfs:subClassOf obo:MI_0378 . obo:MI_0380 obo:IAO_0000115 "Molecules labelled with isotope 15 of nytrogen atoms." ; oboInOwl:hasExactSynonym "15N", "N15" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0380" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "15n label" ; rdfs:subClassOf obo:MI_0378 . obo:MI_0381 obo:IAO_0000115 "Molecules labelled with isotope 2 of hydrogen atoms." ; oboInOwl:hasExactSynonym "2H2", "D2", "deuterium" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0381" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "2h label" ; rdfs:subClassOf obo:MI_0378 . obo:MI_0382 obo:IAO_0000115 "Region of a molecule whose mutation or deletion increases significantly interaction strength or rate (in the case of interactions inferred from enzymatic reaction)." ; oboInOwl:hasExactSynonym "mutation increasing" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0382" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "mutation increasing interaction" ; rdfs:subClassOf obo:MI_0118 . obo:MI_0383 obo:IAO_0000115 "Molecule consisting of a specific sequence of amino acidic or nucleotidic monomers strung together through chemical bonds." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0383" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "biopolymer" ; rdfs:subClassOf obo:MI_0313 . obo:MI_0384 obo:IAO_0000115 "All Alexa dyes are fluorescent iodoacetamide dyes that can be conjugated with the primary amines of biomolecules. All Alexa dyes and their conjugates are more fluorescent and more photostable than the commonly used dyes. The numbers in the Alexa names indicate the approximate excitation wavelength maximum in nm)." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0384" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "alexa label" ; rdfs:subClassOf obo:MI_0857 . obo:MI_0385 obo:IAO_0000115 "Alexa fluorescent dye analogue to AMCA (7-amino-4-methylcoumarin-3-acetic acid) with an approximate excitation wavelength maximum of 350 nm." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0385" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "alexa 350 label" ; rdfs:subClassOf obo:MI_0384 . obo:MI_0386 obo:IAO_0000115 "Alexa fluorescent dye analogue to Lucifer Yellow with an approximate excitation wavelength maximum of 430 nm." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0386" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "alexa 430 label" ; rdfs:subClassOf obo:MI_0384 . obo:MI_0387 obo:IAO_0000115 "Alexa fluorescent dye analogue to Oregon Green 488 with an approximate excitation wavelength maximum of 488 nm." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0387" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "alexa 488 label" ; rdfs:subClassOf obo:MI_0384 . obo:MI_0388 obo:IAO_0000115 "Alexa fluorescent dye analogue to Rhodamine 6G with an approximate excitation wavelength maximum of 532nm." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0388" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "alexa 532 label" ; rdfs:subClassOf obo:MI_0384 . obo:MI_0389 obo:IAO_0000115 "Alexa fluorescent dye analogue to Cy3 with an approximate excitation wavelength maximum of 546nm." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0389" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "alexa 546 label" ; rdfs:subClassOf obo:MI_0384 . obo:MI_0390 obo:IAO_0000115 "Alexa fluorescent dye analogue to Rhodamine Red-X with an approximate excitation wavelength maximum of 568nm." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0390" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "alexa 568 label" ; rdfs:subClassOf obo:MI_0384 . obo:MI_0391 obo:IAO_0000115 "Alexa fluorescent dye analogue to Texas Red-X with an approximate excitation wavelength maximum of 594nm." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0391" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "alexa 594 label" ; rdfs:subClassOf obo:MI_0384 . obo:MI_0396 obo:IAO_0000115 "Molecule whose sequence identity is not checked and has been assumed from external or previous experimental evidence(s)." ; oboInOwl:hasExactSynonym "predetermined" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0396" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "predetermined participant" ; rdfs:subClassOf obo:MI_0661 . obo:MI_0397 obo:IAO_0000115 "Two-hybrid screening can be done in a colony array format, in which each colony expresses a defined pair of proteins. Because the particular protein pair expressed in each colony is defined by its position in the array, positive signals identify interacting proteins without further characterization, thus obviating the need for DNA purification and sequencing. The interrogation of a two-hybrid colony array usually involves a mating strategy in which every DNA binding domain hybrid (the bait) is tested against all activation domain hybrids (the preys) in a grid pattern. Arrays usually use full-length open reading frames." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0397" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "two hybrid array" ; rdfs:subClassOf obo:MI_0018 . obo:MI_0398 obo:IAO_0000115 "In the pooling strategy sets of either both bait and prey hybrid vectors are mated or, more commonly, individual baits are mated against pools of preys. This approach required cloning baits and preys into both two-hybrid vectors, followed by pooling sets of transformants. The positive double hybrid clones are the interacting partners. The pooling of both baits and prey molecules is now a rarely used technique as the pooling of baits often leads to misleading results." ; oboInOwl:hasExactSynonym "two hybrid pooling" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0398" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "two hybrid pooling approach" ; rdfs:subClassOf obo:MI_0018 . obo:MI_0399 obo:IAO_0000115 "Individual baits are mated against pools of random fragmented preys. The usage of degenerated fragment allows identification of the minimal protein region required for the interaction. Since multiple clones that encode overlapping regions of protein are often identified, the minimal domain for interaction may be readily apparent from the initial screen." ; oboInOwl:hasExactSynonym "2h fragment pooling" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0399" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "two hybrid fragment pooling approach" ; rdfs:subClassOf obo:MI_1112 . obo:MI_0400 obo:IAO_0000115 "Techniques which depend upon the strength of the interaction between two entities." ; oboInOwl:hasExactSynonym "affinity techniques" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0400" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "affinity technology" ; rdfs:subClassOf obo:MI_0401 . obo:MI_0401 obo:IAO_0000115 "The application of chemical principles and methods to biological experiments to demonstrate an interaction." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0401" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "biochemical" ; rdfs:subClassOf obo:MI_0045 . obo:MI_0402 obo:IAO_0000115 "Chromatin immunoprecipitation (ChIP) is a powerful approach that allows one to define the interaction of factors with specific chromosomal sites in living cells. An antibody against a protein suspected of binding a given cis-element is used to immunoprecipitate fragmented chromatin fragments. Cells or tissue may first be briefly treated with an agent such formaldehyde to crosslink proteins to DNA. Nucleic acids are then identified by sequencing, for example polymerase chain reaction analysis of the immunoprecipitate with primers flanking the cis-element or next-generation sequencing techniques" ; oboInOwl:hasExactSynonym "ch-ip" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0402" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "chromatin immunoprecipitation assay" ; rdfs:subClassOf obo:MI_0019 . obo:MI_0403 obo:IAO_0000115 "Coincident occurrence of molecules in a given subcellular fraction observed with a low resolution methodology from which a physical interaction among those molecules cannot be inferred." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0403" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "colocalization" ; rdfs:subClassOf obo:MI_0190 . obo:MI_0404 obo:IAO_0000115 "A method allowing the detection of strong interactions between two or more molecules as running, all of them, within a single band in a non-denaturing gel." ; oboInOwl:hasExactSynonym "comig non denat gel" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0404" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "comigration in non denaturing gel electrophoresis" ; rdfs:subClassOf obo:MI_0807 . obo:MI_0405 obo:IAO_0000115 "Competitive binding experiments measure equilibrium binding of a single concentration of ligand at various concentrations of an unlabeled competitor. Analysis of these data gives the affinity of the receptor for the competitor." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0405" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "competition binding" ; rdfs:subClassOf obo:MI_0400 . obo:MI_0406 obo:IAO_0000115 "Measures the catalysis of the hydrolysis of an acetyl group or groups from a substrate molecule." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0406" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "deacetylase assay" ; rdfs:subClassOf obo:MI_0415 . obo:MI_0407 obo:IAO_0000115 "Interaction between molecules that are in direct contact with each other." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0407" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "direct interaction" ; rdfs:subClassOf obo:MI_0915 . obo:MI_0408 obo:IAO_0000115 "Covalent bond mediated by 2 sulfur atoms." ; oboInOwl:hasExactSynonym "SS-bond", "disulfide bridge" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0408" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "disulfide bond" ; rdfs:subClassOf obo:MI_0195 . obo:MI_0409 obo:IAO_0000115 """Experimental method used to identify the region of a nucleic acid involved in an interaction with a protein. One sample of a radiolabeled nucleic acid of known sequence is submitted to partial digestion. A second sample is incubated with its interacting partner and then is submitted to the same partial digestion. The two samples are then analyzed in parallel by electrophoresis on a denaturing acrylamide gel. After autoradiography the identification of the bands that correspond to fragments missing from the lane loaded with the second sample reveals the region of the nucleic acid that is protected from nuclease digestion upon binding. OBSOLETE because redundant with MI:0417 'footprinting' combined with interactor type MI:0319 'DNA' replace by:MI:0417""" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0409" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "dna footprinting" ; owl:deprecated true . obo:MI_0410 obo:IAO_0000115 "Three-dimensional (3D) reconstruction of single, transparent objects from a collection of projection images recorded with a transmission electron microscope. It offers the opportunity to obtain 3D information on structural cellular arrangements with a high resolution." ; oboInOwl:hasExactSynonym "3D-EM", "electron tomog" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0410" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "3D electron microscopy" ; rdfs:subClassOf obo:MI_0020 . obo:MI_0411 obo:IAO_0000115 "Following non-covalent binding of a purified primary ligand to a solid phase, a blocking reagent is added to prevent any non-specific binding. A specific antigen is then allowed to bind to the primary ligand. Unbound antigen is removed by washing and a secondary antibody conjugated to an enzyme (e.g. horseradish peroxidase) is added. Following a washing step to remove unbound secondary ligand, the extent to which a chromogenic substrate (e.g. 3,3', 5,5' tetramethyl benzidine chromogen [TMB]) is converted to a soluble coloured product by the conjugated enzyme in a given time is determined by spectrophotometry using a standard microplate absorbance reader. A similar type of approach can be utilized to detect enzymatic activities. The substrate, attached to a solid phase is incubated in the presence of the enzyme and the enzymatic modification is monitored by an antibody that is specific for the modified substrate (for instance a phosphorylated protein)." ; oboInOwl:hasExactSynonym "ELISA", "elisa" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0411" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "enzyme linked immunosorbent assay" ; rdfs:subClassOf obo:MI_0421, obo:MI_0892 . obo:MI_0412 obo:IAO_0000115 "The EMSA supershift is a EMSA experiment carried out using a third lane loaded with the radiolabeled nucleic acid, a protein mixture and an antibody for a specific protein. If an extra retardation is observed, this is due to the formation of a larger complex including the antibody. By this approach, at least one protein of the complex is directly identified." ; oboInOwl:hasExactSynonym "emsa supershift" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0412" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "electrophoretic mobility supershift assay" ; rdfs:subClassOf obo:MI_0413 . obo:MI_0413 obo:IAO_0000115 "This method proves the interaction between a nucleic acid and a protein partner. On the same electrophoresis gel 1 lane is loaded with a nucleic acid of known sequence, a second lane is loaded with the same nucleic acid together with a purified protein (or a protein mixture). The nucleic acid is often radio-labelled to enable visualisation by autoradiography. Comparison of the nucleic acid migration in the two lanes enables the retardation of the nucleic acid due to its interaction with a protein to be observed." ; oboInOwl:hasExactSynonym "Gel retardation assay", "band shift", "emsa" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0413" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "electrophoretic mobility shift assay" ; rdfs:subClassOf obo:MI_0807 . obo:MI_0414 obo:IAO_0000115 "terms aiming to represent biochemical reactions referring to their resulting product modifications." ; oboInOwl:hasExactSynonym "Biochemical reaction" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0414" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "enzymatic reaction" ; rdfs:subClassOf obo:MI_0407 . obo:MI_0415 obo:IAO_0000115 "Participants are enzyme or substrate in a biochemical reaction." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0415" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "enzymatic study" ; rdfs:subClassOf obo:MI_0401 . obo:MI_0416 obo:IAO_0000115 "Fluorescent microscopy uses a high intensity light to illuminate the sample. This light excites fluorescence species in the sample, which then emit light of a longer wavelength. A fluorescent microscope also produces a magnified image of the sample, but the image is based on the second light source -- the light emanating from the fluorescent species -- rather than from the light originally used to illuminate, and excite, the sample." ; oboInOwl:hasExactSynonym "fluorescence imaging" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0416" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "fluorescence microscopy" ; rdfs:subClassOf obo:MI_0428 . obo:MI_0417 obo:IAO_0000115 "Footprinting analysis is used to identify regions of molecules involved in binding other macromolecules and therefore protected from the effects of degradative enzymes, chemical treatment or other deleterious treatments." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0417" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "footprinting" ; rdfs:subClassOf obo:MI_0401 . obo:MI_0418 obo:IAO_0000115 """methods supporting genetic interactions. OBSOLETE as too unspecific use Genetic interference instead MI:0254.""" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0418" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "genetic" ; owl:deprecated true . obo:MI_0419 obo:IAO_0000115 "Measures the catalysis of the reaction: GTP + H2O = GDP + phosphate." ; oboInOwl:hasExactSynonym "GTPase", "gtp hydrolisis" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0419" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "gtpase assay" ; rdfs:subClassOf obo:MI_0879 . obo:MI_0420 obo:IAO_0000115 "Measures quenching of the nonradiative energy transfer between fluorescent long-lifetime lanthanide chelates and different acceptors. Relies on a fluorescence energy donor and acceptor being added from close proximity on the phosphorylated substrate due to the action of the kinase." ; oboInOwl:hasExactSynonym "homogeneous time-resolved fluorescence", "kinase HTRF", "kinase htrf" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0420" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "kinase homogeneous time resolved fluorescence" ; rdfs:subClassOf obo:MI_0424, obo:MI_0510 . obo:MI_0421 obo:IAO_0000115 "Antibody mediated participant identification." ; oboInOwl:hasExactSynonym "antibody detection" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0421" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "identification by antibody" ; rdfs:subClassOf obo:MI_0661 . obo:MI_0422 obo:IAO_0000115 "Method using an antibody coupled with some colouring agent to detect a specific protein within a cell or tissue sample. In some cases the primary antibody is directly linked to a colouring agent, more often the primary antibody is targeted by a secondary antibody, targeting the primary antibody." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0422" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "immunostaining" ; rdfs:subClassOf obo:MI_0421 . obo:MI_0423 obo:IAO_0000115 "Substrate protein radio-labelled by kinase transferring an isotope of phosphate from the nucleotide. Substrate isolated by gel electrophoresis and radio-labelling confirmed by autoradiography." ; oboInOwl:hasExactSynonym "in gel kinase assay" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0423" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "in-gel kinase assay" ; rdfs:subClassOf obo:MI_0424 . obo:MI_0424 obo:IAO_0000115 "Catalysis of the transfer of a phosphate group, usually from ATP, to a protein substrate." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0424" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "protein kinase assay" ; rdfs:subClassOf obo:MI_0841 . obo:MI_0425 obo:IAO_0000115 "Relies on the radiolabelling of a peptide substrate immobilized on a scintillant coated SPA-bead. The kinase transfers a phosphate isotope from the nucleotide to the substrate." ; oboInOwl:hasExactSynonym "kinase spa" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0425" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "kinase scintillation proximity assay" ; rdfs:subClassOf obo:MI_0099, obo:MI_0424 . obo:MI_0426 obo:IAO_0000115 "Light visible microscopy uses environmental light to illuminate the sample and produce a magnified image of the sample." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0426" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "light microscopy" ; rdfs:subClassOf obo:MI_0428 . obo:MI_0427 obo:IAO_0000115 "identification by mass spectrometry." ; oboInOwl:hasExactSynonym "ms participant" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0427" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "Identification by mass spectrometry" ; rdfs:subClassOf obo:MI_0661 . obo:MI_0428 obo:IAO_0000115 "Methods that provide images of molecules at various resolution depending on the technology used." ; oboInOwl:hasExactSynonym "microscopy" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0428" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "imaging technique" ; rdfs:subClassOf obo:MI_0045 . obo:MI_0429 obo:IAO_0000115 "A sequence range within a molecule identified as being absolutely required for an interaction. The sequence may or may not be in direct physical contact with the interaction partner." ; oboInOwl:hasExactSynonym "deletion disrupting interaction", "necessary binding site", "required to bind" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0429" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "necessary binding region" ; rdfs:subClassOf obo:MI_0117, obo:MI_0573, obo:MI_1128, obo:MI_1129 . obo:MI_0430 obo:IAO_0000115 "Nucleic acids are incubated with purified proteins or a protein mixture and then exposed to a chemical cross-linking agent that may be activated by UV light exposure. The eventual complexes can be identified by sequencing or autoradiography if the nucleic acid is radio-labelled and the sequence is known. The proteins involved in the complex can be recognized by specific antibodies or by retrieving the original protein mixture and carrying further analysis on it." ; oboInOwl:hasExactSynonym "nucl ac uv crosslink" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0430" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "nucleic acid uv cross-linking assay" ; rdfs:subClassOf obo:MI_0030 . obo:MI_0431 obo:IAO_0000115 """Deprecated terms. OBSOLETE term replaced by the default OBO class 'Obsolete'.""" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0431" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "obsolete" ; owl:deprecated true . obo:MI_0432 obo:IAO_0000115 "Protein-DNA complementation assay where a single promoter act as bait and is screened against a library of prey transcription factors." ; oboInOwl:hasExactSynonym "1 hybrid", "one-hybrid", "yeast one hybrid", "yeast one-hybrid" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0432" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "one hybrid" ; rdfs:subClassOf obo:MI_0232 . obo:MI_0433 obo:IAO_0000115 "partial protein sequence identification." ; oboInOwl:hasExactSynonym "partial id prot seq" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0433" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "partial identification of protein sequence" ; rdfs:subClassOf obo:MI_0093, obo:MI_0659 . obo:MI_0434 obo:IAO_0000115 "Measures the catalysis of the reaction: a phosphosubstrate + H2O = a substrate + phosphate." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0434" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "phosphatase assay" ; rdfs:subClassOf obo:MI_0415 . obo:MI_0435 obo:IAO_0000115 "Measures the enzymatic hydrolysis of a peptide bond within a peptide or protein substrate." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0435" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "protease assay" ; rdfs:subClassOf obo:MI_0990 . obo:MI_0436 obo:IAO_0000115 "Protein footprinting is a technique for identifying structural changes modulated by protein-ligand binding, and mapping protein-ligand interfaces This technique involves attaching cutting reagents randomly to amino acid residue (e.g. lysine or cysteine) on the proteins surface and then using this lysine-labelled protein to cleave polypeptide backbone of the other protein at exposed residues adjacent to its binding site." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0436" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "protein footprinting" ; rdfs:subClassOf obo:MI_0659 . obo:MI_0437 obo:IAO_0000115 "Two hybrid assay performed with a third protein component co-transfected into a recombinant yeast strain together with a bait and a prey construct. Negative control shows that the interaction between the bait and the prey do not occur when the third protein is not co-transfected." ; oboInOwl:hasExactSynonym "bridge assay", "protein 3-hybrid", "protein tri hybrid", "trihybrid" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0437" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "protein three hybrid" ; rdfs:subClassOf obo:MI_0018, obo:MI_0588 . obo:MI_0438 obo:IAO_0000115 "In vivo reconstruction of specific RNA-proteins interactions. The DNA binding and transcription activator domains of GAL4 are brought together via the interaction of recombinant RNA. The first hybrid protein contains the DNA binding domain of GAL4 fused to RevM10 (a mutated RNA binding protein of HIV-1 that binds specifically to the Rev responsive element RRE of the env gene). A recombinant RNA contains the RRE sequence and a target RNA sequence X. The second hybrid protein contains the activation domain of GAL4 fused to protein Y tested for its ability to bind the target RNA X. If this interaction occurs the three hybrid reconstructs GAL4 and the transcription of a reporter gene is activated." ; oboInOwl:hasExactSynonym "Three hybrid system", "rna 3-hybrid", "rna tri hybrid", "rna-three hybrid" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0438" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "rna three hybrid" ; rdfs:subClassOf obo:MI_0588 . obo:MI_0439 obo:IAO_0000115 "A technique used to detect genetic interactions between 2 (or more) genes in a sporulating organism by scoring a large population of haploid spores for a phenotype and correlating the phenotype with the presence of single vs double (multiple) mutations. A diploid heterozygous organism harbouring mutations in two (or more) genes is induced to sporulate. Resulting spores are meiotic segregants that are haploid and are either wild type or mutant at each locus. Spores are scored for a phenotype, such as loss of viability." ; oboInOwl:hasExactSynonym "RSA", "random-spore analysis", "rsa", "spore germination" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0439" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "random spore analysis" ; rdfs:subClassOf obo:MI_0254 . obo:MI_0440 obo:IAO_0000115 "Saturation binding experiments measure specific ligand binding at equilibrium at various concentrations of the ligand. Analysis of these data can determine receptor number and affinity." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0440" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "saturation binding" ; rdfs:subClassOf obo:MI_0400 . obo:MI_0441 obo:IAO_0000115 "Identification of genetic interactions by generation of an organism harbouring mutations in 2 or more genes and scoring for a phenotype, such as loss of viability, that is not observed for any of the mutations in isolation." ; oboInOwl:hasExactSynonym "SGA", "sga" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0441" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "synthetic genetic analysis" ; rdfs:subClassOf obo:MI_0254 . obo:MI_0442 obo:IAO_0000115 "Binding will occur when this sequence range is present within a molecule or part of a molecule. This region will contain the direct binding region but may be longer." ; oboInOwl:hasExactSynonym "sufficient binding site", "sufficient to bind" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0442" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "sufficient binding region" ; rdfs:subClassOf obo:MI_0117 . obo:MI_0443 obo:IAO_0000115 """Interaction concerning ubiquitin that is covalently attached to any Lys residue of its interaction partner. OBSOLETE remap to ubiquitination reaction (MI:0220) or describe ubiquitine as a participant on the interaction using physical interaction (MI:0218) or covalent binding (MI:0195) as interaction type.""" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0443" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "ubiquitin binding" ; owl:deprecated true . obo:MI_0444 obo:IAO_0000115 "Database citation list names of databases commonly used to cross reference interaction data. http://purl.obolibrary.org/obo/clo.owl" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0444" ; oboInOwl:inSubset mi:Drugable, mi:PSI-MI_slim ; a owl:Class ; rdfs:label "database citation" ; rdfs:subClassOf obo:MI_0000 . obo:MI_0445 obo:IAO_0000115 "Databases acting as a source of literature information." ; oboInOwl:hasExactSynonym "literature xref", "publication xref" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0445" ; oboInOwl:inSubset mi:Drugable, mi:PSI-MI_slim ; a owl:Class ; rdfs:label "literature database" ; rdfs:subClassOf obo:MI_0444 . obo:MI_0446 obo:IAO_0000115 """PubMed is designed to provide access to citations from biomedical literature. The data can be found at both NCBI PubMed and Europe PubMed Central. http://www.ncbi.nlm.nih.gov/pubmed http://europepmc.org""" ; oboInOwl:hasDbXref "id-validation-regexp:", "search-url:" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0446" ; oboInOwl:inSubset mi:Drugable, mi:PSI-MI_slim ; a owl:Class ; rdfs:label "pubmed" ; rdfs:subClassOf obo:MI_0445 . obo:MI_0447 obo:IAO_0000115 "A database describing a feature on a molecule." ; oboInOwl:hasExactSynonym "feature xref" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0447" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "feature database" ; rdfs:subClassOf obo:MI_0444 . obo:MI_0448 obo:IAO_0000115 """The objective of Gene Ontology (GO) is to provide controlled vocabularies for the description of the molecular function, biological process and cellular component of gene products. http://www.ebi.ac.uk/GO""" ; oboInOwl:hasDbXref "id-validation-regexp:", "search-url:" ; oboInOwl:hasExactSynonym "go" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0448" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "gene ontology" ; rdfs:subClassOf obo:MI_0447, obo:MI_0461 . obo:MI_0449 obo:IAO_0000115 """InterPro combines a number of databases (referred to as member databases) that use different methodologies and a varying degree of biological information on well-characterised proteins to derive protein signatures that predict family membership and domain composition of naive protein sequences. https://www.ebi.ac.uk/interpro/""" ; oboInOwl:hasDbXref "id-validation-regexp:", "search-url:" ; oboInOwl:hasExactSynonym "InterPro" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0449" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "interpro" ; rdfs:subClassOf obo:MI_0447 . obo:MI_0450 obo:IAO_0000115 """The Conserved Domain Database may be used to identify the conserved domains present in a protein sequence. http://www.ncbi.nlm.nih.gov/Structure/cdd/cdd.shtml""" ; oboInOwl:hasDbXref "id-validation-regexp:" ; oboInOwl:hasExactSynonym "CDD" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0450" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "cdd" ; rdfs:subClassOf obo:MI_0447 . obo:MI_0451 obo:IAO_0000115 """Pfam is a large collection of multiple sequence alignments and hidden Markov models covering many common protein domains. http://www.sanger.ac.uk/Software/Pfam""" ; oboInOwl:hasDbXref "id-validation-regexp:" ; oboInOwl:hasExactSynonym "Pfam" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0451" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "pfam" ; rdfs:subClassOf obo:MI_0449 . obo:MI_0452 obo:IAO_0000115 """PIRSF is a classification system based on evolutionary relationship of whole proteins. http://pir.georgetown.edu/pirwww/dbinfo/pirsf.shtml""" ; oboInOwl:hasDbXref "id-validation-regexp:" ; oboInOwl:hasExactSynonym "PIRSF" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0452" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "pirsf" ; rdfs:subClassOf obo:MI_0449 . obo:MI_0453 obo:IAO_0000115 """PRINTS is a compendium of protein fingerprints. A fingerprint is a group of conserved motifs used to characterise a protein family. http://umber.sbs.man.ac.uk/dbbrowser/PRINTS/""" ; oboInOwl:hasDbXref "id-validation-regexp:" ; oboInOwl:hasExactSynonym "PRINTS" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0453" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "prints" ; rdfs:subClassOf obo:MI_0449 . obo:MI_0454 obo:IAO_0000115 """The ProDom protein domain database consists of an automatic compilation of homologous domains. http://protein.toulouse.inra.fr/prodom.html""" ; oboInOwl:hasDbXref "id-validation-regexp:" ; oboInOwl:hasExactSynonym "ProDom" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0454" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "prodom" ; rdfs:subClassOf obo:MI_0449 . obo:MI_0455 obo:IAO_0000115 """PROSITE is a database of protein families and domains. It consists of biologically significant sites, patterns and profiles. http://us.expasy.org/prosite/""" ; oboInOwl:hasDbXref "id-validation-regexp:" ; oboInOwl:hasExactSynonym "Prosite" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0455" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "prosite" ; rdfs:subClassOf obo:MI_0449 . obo:MI_0456 obo:IAO_0000115 """SUPERFAMILY is a library of profile hidden Markov models that represent all proteins of known structure. The library is based on the SCOP classification of proteins: each model corresponds to a SCOP domain. http://supfam.mrc-lmb.cam.ac.uk/SUPERFAMILY/""" ; oboInOwl:hasDbXref "id-validation-regexp:" ; oboInOwl:hasExactSynonym "SCOP superfamily" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0456" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "scop superfamily" ; rdfs:subClassOf obo:MI_0449 . obo:MI_0457 obo:IAO_0000115 """SMART (a Simple Modular Architecture Research Tool) allows the identification and annotation of genetically mobile domains and the analysis of domain architectures. http://smart.embl-heidelberg.de/""" ; oboInOwl:hasDbXref "id-validation-regexp:" ; oboInOwl:hasExactSynonym "SMART" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0457" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "smart" ; rdfs:subClassOf obo:MI_0449 . obo:MI_0458 obo:IAO_0000115 """TIGRFAMs is a collection of protein families, featuring curated multiple sequence alignments, Hidden Markov Models (HMMs) and annotation. http://www.tigr.org/TIGRFAMs""" ; oboInOwl:hasDbXref "id-validation-regexp:" ; oboInOwl:hasExactSynonym "TIGRFAMs" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0458" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "tigrfams" ; rdfs:subClassOf obo:MI_0449 . obo:MI_0459 obo:IAO_0000115 """MMDB (Molecular Modeling DataBase), is a subset of three-dimensional structures obtained from the Protein Data Bank. http://www.ncbi.nlm.nih.gov/Structure""" ; oboInOwl:hasDbXref "id-validation-regexp:" ; oboInOwl:hasExactSynonym "MMDB" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0459" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "mmdb" ; rdfs:subClassOf obo:MI_0447, obo:MI_0461 . obo:MI_0460 obo:IAO_0000115 """The RCSB PDB provides a variety of tools and resources for studying the structures of biological macromolecules and their relationships to sequence, function, and disease. http://www.pdb.org/""" ; oboInOwl:hasDbXref "id-validation-regexp:", "search-url:" ; oboInOwl:hasExactSynonym "PDB" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0460" ; oboInOwl:inSubset mi:Drugable, mi:PSI-MI_slim ; a owl:Class ; rdfs:label "rcsb pdb" ; rdfs:subClassOf obo:MI_0805 . obo:MI_0461 obo:IAO_0000115 "Databases that contain experimental or predictive molecular interaction data." ; oboInOwl:hasExactSynonym "interaction xref" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0461" ; oboInOwl:inSubset mi:Drugable, mi:PSI-MI_slim ; a owl:Class ; rdfs:label "interaction database" ; rdfs:subClassOf obo:MI_0444 . obo:MI_0462 obo:IAO_0000115 """The Biomolecular Interaction Network Database (BIND) is a collection of records documenting molecular interactions. http://www.blueprint.org/bind""" ; oboInOwl:hasDbXref "id-validation-regexp:" ; oboInOwl:hasExactSynonym "BIND" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0462" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "bind" ; rdfs:subClassOf obo:MI_0461, obo:MI_0489 . obo:MI_0463 obo:IAO_0000115 """The General Repository for Interaction Datasets (BioGRID) is a database of genetic and physical interactions. http://thebiogrid.org""" ; oboInOwl:hasExactSynonym "BioGRID" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0463" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "biogrid" ; rdfs:subClassOf obo:MI_0461, obo:MI_0489 . obo:MI_0464 obo:IAO_0000115 """The MIPS Comprehensive Yeast Genome Database (CYGD) aims to present information on the molecular structure and functional network of the entirely sequenced, well-studied model eukaryote, the budding yeast Saccharomyces cerevisiae. In addition the data of various projects on related yeasts are used for comparative analysis. http://mips.gsf.de/proj/yeast/CYGD. http://mips.gsf.de/genre/proj/mpact""" ; oboInOwl:hasDbXref "id-validation-regexp:" ; oboInOwl:hasExactSynonym "CYGD", "CYGD (MIPS)", "MIPS", "MPact" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0464" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "cygd" ; rdfs:subClassOf obo:MI_0489, obo:MI_1094, obo:MI_1106 . obo:MI_0465 obo:IAO_0000115 """The database of interacting protein (DIP) database stores experimentally determined interactions between proteins. It combines information from a variety of sources to create a single, consistent set of protein-protein interactions. http://dip.doe-mbi.ucla.edu/""" ; oboInOwl:hasDbXref "id-validation-regexp:", "search-url:" ; oboInOwl:hasExactSynonym "DIP" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0465" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "dip" ; rdfs:subClassOf obo:MI_0461, obo:MI_0973 . obo:MI_0466 obo:IAO_0000115 """EcoCyc is a bioinformatics database that describes the genome and the biochemical machinery of E. coli K12 MG1655. http://ecocyc.org/""" ; oboInOwl:hasExactSynonym "EcoCyc" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0466" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "ecocyc" ; rdfs:subClassOf obo:MI_1106 . obo:MI_0467 obo:IAO_0000115 """The Reactome project is a collaboration among Cold Spring Harbor Laboratory, The European Bioinformatics Institute, and The Gene Ontology Consortium to develop a curated resource of core pathways and reactions in human biology. http://www.reactome.org/""" ; oboInOwl:hasDbXref "id-validation-regexp:", "search-url:" ; oboInOwl:hasExactSynonym "GKB", "Genome Knowledge Base", "Reactome" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0467" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "reactome" ; rdfs:subClassOf obo:MI_1106 . obo:MI_0468 obo:IAO_0000115 """The Human Protein Reference Database represents a centralized platform to visually depict and integrate information pertaining to domain architecture, post-translational modifications, interaction networks and disease association for each protein in the human proteome. http://www.hprd.org/""" ; oboInOwl:hasExactSynonym "HPRD" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0468" ; oboInOwl:inSubset mi:Drugable, mi:PSI-MI_slim ; a owl:Class ; rdfs:label "hprd" ; rdfs:subClassOf obo:MI_0461 . obo:MI_0469 obo:IAO_0000115 """INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact""" ; oboInOwl:hasDbXref "id-validation-regexp:", "search-url:" ; oboInOwl:hasExactSynonym "IntAct", "intact" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0469" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "intact" ; rdfs:subClassOf obo:MI_0461, obo:MI_0973 . obo:MI_0470 obo:IAO_0000115 """KEGG (Kyoto Encyclopedia of Genes and Genomes) is a knowledge base for systematic analysis of gene functions, linking genomic information with higher order functional information and also supplies information about chemical compounds, enzyme molecules and enzymatic reactions. http://www.genome.ad.jp/kegg/""" ; oboInOwl:hasDbXref "id-validation-regexp:" ; oboInOwl:hasExactSynonym "KEGG" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0470" ; oboInOwl:inSubset mi:Drugable, mi:PSI-MI_slim ; a owl:Class ; rdfs:label "kegg" ; rdfs:subClassOf obo:MI_0473, obo:MI_1106 . obo:MI_0471 obo:IAO_0000115 """The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it""" ; oboInOwl:hasDbXref "id-validation-regexp:", "search-url:" ; oboInOwl:hasExactSynonym "MINT" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0471" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "mint" ; rdfs:subClassOf obo:MI_0461, obo:MI_0973 . obo:MI_0472 obo:IAO_0000115 """The Protein Data Bank in Europe - the European project for the collection, management and distribution of data about macromolecular structures, derived in part from the Protein Data Bank (PDB). http://www.ebi.ac.uk/pdbe/""" ; oboInOwl:hasDbXref "id-validation-regexp:", "search-url:" ; oboInOwl:hasExactSynonym "PQS", "e-MSD" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:hasRelatedSynonym "MSD" ; oboInOwl:id "MI:0472" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "pdbe" ; rdfs:subClassOf obo:MI_0805 . obo:MI_0473 obo:IAO_0000115 "Database of molecules participating in molecular interactions." ; oboInOwl:hasExactSynonym "participant xref" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0473" ; oboInOwl:inSubset mi:Drugable, mi:PSI-MI_slim ; a owl:Class ; rdfs:label "participant database" ; rdfs:subClassOf obo:MI_0444 . obo:MI_0474 obo:IAO_0000115 """A definitive, freely available database of Chemical compounds of Biological Interest (ChEBI). http://www.ebi.ac.uk/chebi/""" ; oboInOwl:hasDbXref "id-validation-regexp:", "search-url:" ; oboInOwl:hasExactSynonym "ChEBI" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0474" ; oboInOwl:inSubset mi:Drugable, mi:PSI-MI_slim ; a owl:Class ; rdfs:label "chebi" ; rdfs:subClassOf obo:MI_2054 . obo:MI_0475 obo:IAO_0000115 """DDBJ EMBL GenBank Nucleotide Sequence Database Collaboration exchange new and updated data on a daily basis to achieve optimal synchronisation. http://www.ebi.ac.uk/embl/Contact/collaboration""" ; oboInOwl:hasDbXref "id-validation-regexp:", "search-url:" ; oboInOwl:hasExactSynonym "DDBJ", "DDBJ/EMBL/GenBank", "EMBL", "GenBank" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0475" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "ddbj/embl/genbank" ; rdfs:subClassOf obo:MI_0683 . obo:MI_0476 obo:IAO_0000115 """Ensembl is a joint project between the EMBL-EBI and the Wellcome Trust Sanger Institute that aims at developing a system that maintains automatic annotation of large eukaryotic genomes. http://www.ensembl.org""" ; oboInOwl:hasDbXref "id-validation-regexp:", "search-url:" ; oboInOwl:hasExactSynonym "Ensembl" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0476" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "ensembl" ; rdfs:subClassOf obo:MI_1094 . obo:MI_0477 obo:IAO_0000115 """LocusLink provides a single query interface to curated sequence and descriptive information about genetic loci. http://www.ncbi.nlm.nih.gov/LocusLink/""" ; oboInOwl:hasDbXref "id-validation-regexp:" ; oboInOwl:hasExactSynonym "Entrez gene/locuslink", "entrezgene/locuslink" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0477" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "entrez gene/locuslink" ; rdfs:subClassOf obo:MI_1109 . obo:MI_0478 obo:IAO_0000115 """FlyBase is a comprehensive database for information on the genetics and molecular biology of Drosophila. http://flybase.org""" ; oboInOwl:hasDbXref "id-validation-regexp:", "search-url:" ; oboInOwl:hasExactSynonym "FlyBase" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0478" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "flybase" ; rdfs:subClassOf obo:MI_1094 . obo:MI_0479 obo:IAO_0000115 """Mouse Genome Informatics (MGI) provides integrated access to data on the genetics, genomics, and biology of the laboratory mouse. http://www.informatics.jax.org/""" ; oboInOwl:hasDbXref "id-validation-regexp:" ; oboInOwl:hasExactSynonym "MGD/MGI" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0479" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "mgd/mgi" ; rdfs:subClassOf obo:MI_1094 . obo:MI_0480 obo:IAO_0000115 """Online Mendelian Inheritance in Man (OMIM) is a catalogue of human genes and genetic disorders, with links to literature references, sequence records, maps, and related databases. http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=OMIM""" ; oboInOwl:hasDbXref "id-validation-regexp:", "search-url:" ; oboInOwl:hasExactSynonym "OMIM" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0480" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "omim" ; rdfs:subClassOf obo:MI_0683 . obo:MI_0481 obo:IAO_0000115 """The Reference Sequence (RefSeq) collection aims to provide a comprehensive, integrated, non-redundant set of sequences, including genomic DNA, transcript (RNA), and protein products, for a number of organisms. http://www.ncbi.nlm.nih.gov/RefSeq/""" ; oboInOwl:hasDbXref "id-validation-regexp:" ; oboInOwl:hasExactSynonym "Refseq" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0481" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "refseq" ; rdfs:subClassOf obo:MI_1096 . obo:MI_0482 obo:IAO_0000115 """Rfam is a large collection of multiple sequence alignments and covariance models covering many common non-coding RNA families. http://www.sanger.ac.uk/Software/Rfam/""" ; oboInOwl:hasDbXref "id-validation-regexp:" ; oboInOwl:hasExactSynonym "rfam" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0482" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "rfam" ; rdfs:subClassOf obo:MI_0683 . obo:MI_0483 obo:IAO_0000115 """The Rat Genome Database (RGD) curates and integrates rat genetic and genomic data. http://rgd.mcw.edu/""" ; oboInOwl:hasDbXref "id-validation-regexp:" ; oboInOwl:hasExactSynonym "RGD" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0483" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "rgd" ; rdfs:subClassOf obo:MI_1094 . obo:MI_0484 obo:IAO_0000115 """SGD is a scientific database of the molecular biology and genetics of the yeast Saccharomyces cerevisiae. http://www.yeastgenome.org/""" ; oboInOwl:hasDbXref "id-validation-regexp:", "search-url:" ; oboInOwl:hasExactSynonym "SGD", "Saccharomyces Genome Database" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0484" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "sgd" ; rdfs:subClassOf obo:MI_1094 . obo:MI_0485 obo:IAO_0000115 """UniProt Archive (UniParc) is part of UniProt project. It is a non-redundant archive of protein sequences derived from many sources. http://www.ebi.ac.uk/uniparc/""" ; oboInOwl:hasDbXref "id-validation-regexp:", "search-url:" ; oboInOwl:hasExactSynonym "UniParc" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0485" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "uniparc" ; rdfs:subClassOf obo:MI_1097 . obo:MI_0486 obo:IAO_0000115 """UniProt (Universal Protein Resource) is the world's most comprehensive catalogue of information on proteins. It is a central repository of protein sequence and function created by joining the information contained in Swiss-Prot, TrEMBL, and PIR. http://www.uniprot.org""" ; oboInOwl:hasDbXref "id-validation-regexp:", "search-url:" ; oboInOwl:hasExactSynonym "UniProtKB", "uniprotkb" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0486" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "uniprot knowledge base" ; rdfs:subClassOf obo:MI_0461, obo:MI_0973, obo:MI_1097 . obo:MI_0487 obo:IAO_0000115 """WormBase is the central worm database that houses the gene reports, locus reports, translation reports, expression pattern data and genome browser. http://www.wormbase.org/""" ; oboInOwl:hasDbXref "id-validation-regexp:" ; oboInOwl:hasExactSynonym "WormBase" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0487" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "wormbase" ; rdfs:subClassOf obo:MI_1094 . obo:MI_0488 obo:IAO_0000115 "PSI-MI." ; oboInOwl:hasDbXref "id-validation-regexp:", "search-url:" ; oboInOwl:hasExactSynonym "PSI-MI" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0488" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "psi-mi" ; rdfs:subClassOf obo:MI_0444 . obo:MI_0489 obo:IAO_0000115 "Database that originally provided the interaction record for exchange purposes." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0489" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "source database" ; rdfs:subClassOf obo:MI_0444 . obo:MI_0490 obo:IAO_0000115 """Describes the location of the experiment. OBSOLETE as a full host organisms description is recommended using tax id == -1 as convention to refer to 'in vitro' interaction.""" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0490" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "experiment condition" ; owl:deprecated true . obo:MI_0491 obo:IAO_0000115 """Results generated by predictive bioinformatics approaches rather than experimental data. OBSOLETE as a full host organisms description is recommended using tax id == -1 as convention to refer to 'in vitro' interaction.""" ; oboInOwl:hasExactSynonym "Predictive" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0491" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "in silico" ; owl:deprecated true . obo:MI_0492 obo:IAO_0000115 """Experiments performed with participants removed from the cellular environment e.g. cell extracts, isolated proteins. OBSOLETE as a full host organisms description is recommended using tax id == -1 as convention to refer to 'in vitro' interaction.""" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0492" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "in vitro" ; owl:deprecated true . obo:MI_0493 obo:IAO_0000115 """Experiment undertaken within a cellular environment, although this may not be the natural host of the proteins in the study. OBSOLETE as a full host organisms description is recommended using tax id == -1 as convention to refer to 'in vitro' interaction.""" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0493" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "in vivo" ; owl:deprecated true . obo:MI_0494 obo:IAO_0000115 """Literally, in place i.e. the protein is in its natural environment during the experiment. OBSOLETE as a full host organisms is recommended using tax id == -1 as convention to refer to 'in vitro' interaction.""" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0494" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "in situ" ; owl:deprecated true . obo:MI_0495 obo:IAO_0000115 "Role played by the participant within the experiment." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0495" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "experimental role" ; rdfs:subClassOf obo:MI_0000 . obo:MI_0496 obo:IAO_0000115 "Molecule experimentally treated to capture its interacting partners." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0496" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "bait" ; rdfs:subClassOf obo:MI_0495 . obo:MI_0497 obo:IAO_0000115 "Molecule role in an experimental setting that does not have an embedded asymmetry." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0497" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "neutral component" ; rdfs:subClassOf obo:MI_0495 . obo:MI_0498 obo:IAO_0000115 "Molecule experimentally identified as being captured by a given bait." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0498" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "prey" ; rdfs:subClassOf obo:MI_0495 . obo:MI_0499 obo:IAO_0000115 "Role not specified or not applicable to the data." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0499" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "unspecified role" ; rdfs:subClassOf obo:MI_0495, obo:MI_0500 . obo:MI_0500 obo:IAO_0000115 "Physiological role of an interactor in a cell or in vivo environment, which is reproduced in the current experiment." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0500" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "biological role" ; rdfs:subClassOf obo:MI_0000 . obo:MI_0501 obo:IAO_0000115 "Molecule catalyzing a modification on its interacting partner." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0501" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "enzyme" ; rdfs:subClassOf obo:MI_0500 . obo:MI_0502 obo:IAO_0000115 "Molecule that is the target of its binding partner catalytic activity." ; oboInOwl:hasExactSynonym "substrate" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0502" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "enzyme target" ; rdfs:subClassOf obo:MI_0500 . obo:MI_0503 obo:IAO_0000115 "Molecule that makes intramolecular interactions." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0503" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "self" ; rdfs:subClassOf obo:MI_0495, obo:MI_0500 . obo:MI_0505 obo:IAO_0000115 "The form of a molecule that was actually used to experimentally demonstrate the interaction, that may differ from the sequence described by the identifying accession number." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0505" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "experimental feature" ; rdfs:subClassOf obo:MI_0116 . obo:MI_0506 obo:IAO_0000115 "A molecule is estimated to be expressed at higher levels than in physiological condition." ; oboInOwl:hasExactSynonym "over-expressed" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0506" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "over expressed level" ; rdfs:subClassOf obo:MI_0221, obo:MI_0803 . obo:MI_0507 obo:IAO_0000115 "Small molecules, peptides or full proteins that can be used as label as they confer some property that facilitates identification purification and monitoring to the labeled molecule." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0507" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "tag" ; rdfs:subClassOf obo:MI_0505 . obo:MI_0508 obo:IAO_0000115 "Measures the release of radiolabelled acetic acid from a pre-labeled molecule." ; oboInOwl:hasExactSynonym "radiolabeled acetate" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0508" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "deacetylase radiometric assay" ; rdfs:subClassOf obo:MI_0406 . obo:MI_0509 obo:IAO_0000115 "Measures quenching of the nonradiative energy transfer between fluorescent long-lifetime lanthanide chelates and different acceptors. Relies on a fluorescence energy donor and acceptor being removed from close proximity on the phosphorylated substrate due to the action of the phosphatase." ; oboInOwl:hasExactSynonym "homogeneous time-resolved fluorescence", "phosphatase HTRF", "phosphatase htrf" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0509" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "phosphatase homogeneous time resolved fluorescence" ; rdfs:subClassOf obo:MI_0434, obo:MI_0510 . obo:MI_0510 obo:IAO_0000115 "Methods based on the exceptionally long fluorescence lifetime characteristics of certain fluorophores, which allows the elimination of the effects of background fluorescence. Uses nonradiative energy transfer or quenching between fluorescent lanthanide chelates and different acceptors to measure reaction rates." ; oboInOwl:hasExactSynonym "homogeneous time-resolved fluorescence", "htrf" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0510" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "homogeneous time resolved fluorescence" ; rdfs:subClassOf obo:MI_0051 . obo:MI_0511 obo:IAO_0000115 "Measures quenching of the nonradiative energy transfer between fluorescent long-lifetime lanthanide chelates and different acceptors. Fluorescence donor and acceptor are on the same peptide molecule and separated by the action of the protease." ; oboInOwl:hasExactSynonym "Protease HTRF", "protease htrf" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0511" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "protease homogeneous time resolved fluorescence" ; rdfs:subClassOf obo:MI_0435, obo:MI_0510 . obo:MI_0512 obo:IAO_0000115 "Samples run on a gelatine containing gels under non-reducing condition, gels then incubated under conditions in which the enzyme is active. Gels are stained with coomasie and gelatine-free regions of the gel taken as a measure of enzyme activity." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0512" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "zymography" ; rdfs:subClassOf obo:MI_0435 . obo:MI_0513 obo:IAO_0000115 "Measures the amount of radiolabel released into the medium when enzyme is added onto a film of isotope-labelled collagen." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0513" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "collagen film assay" ; rdfs:subClassOf obo:MI_0435 . obo:MI_0514 obo:IAO_0000115 "Substrate pre-radiolabelled either synthetically or through the action of a kinase transferring an isotope of phosphate from a nucleotide. Substrate then exposed to phosphate under assay conditions. Substrate isolated by gel electrophoresis and loss of radiolabelling confirmed by autoradiography." ; oboInOwl:hasExactSynonym "in gel phosphatase" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0514" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "in gel phosphatase assay" ; rdfs:subClassOf obo:MI_0434 . obo:MI_0515 obo:IAO_0000115 "Measures the catalysis of the transfer of a methyl group to an acceptor molecule." ; oboInOwl:hasExactSynonym "methyltransferase as" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0515" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "methyltransferase assay" ; rdfs:subClassOf obo:MI_0415 . obo:MI_0516 obo:IAO_0000115 "Measures the transfer of a radiolabelled methyl group of a donor, for example S-adenosyl-L-methionine (SAM) to a carboxyl group of an acceptor." ; oboInOwl:hasExactSynonym "radiolabeled methyl" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0516" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "methyltransferase radiometric assay" ; rdfs:subClassOf obo:MI_0515 . obo:MI_0517 obo:IAO_0000115 "A radiolabelled molecule has radio isotopes among its constituent atoms that can be used to identify, localize or quantify the full molecule." ; oboInOwl:hasExactSynonym "radiolabeled", "radiolabelled" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0517" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "radiolabel" ; rdfs:subClassOf obo:MI_0253 . obo:MI_0518 obo:IAO_0000115 "The protein of interest is expressed as a fusion to the peptide DYKDDDDKV for which antibodies are commercially available. Sometimes multiple copies of the peptide are fused in tandem." ; oboInOwl:hasExactSynonym "DYKDDDDKV epitope tag", "FLAG", "FLAG-tagged" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0518" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "flag tag" ; rdfs:subClassOf obo:MI_0507 . obo:MI_0519 obo:IAO_0000115 "The protein is expressed and purified as a fusion to the glutathione S-tranferase protein." ; oboInOwl:hasExactSynonym "glutathione S-tranferase tag", "gst tag" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0519" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "glutathione s tranferase tag" ; rdfs:subClassOf obo:MI_0365 . obo:MI_0520 obo:IAO_0000115 "The protein of interest is expressed as a fusion to the peptide YPYDVPDYA (a fragment of the influenza hemagglutinin protein) for which antibodies are commercially available." ; oboInOwl:hasExactSynonym "YPYDVPDYA epitope tag" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0520" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "ha tag" ; rdfs:subClassOf obo:MI_0507 . obo:MI_0521 obo:IAO_0000115 "The protein of interest is expressed as a fusion to a poly-His tail. This permits purification by chromatography over a metal column or by binding to commercially available anti poly-His antibodies." ; oboInOwl:hasExactSynonym "6-His-tag", "Hexa-His-tag", "Histidine-tag" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0521" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "his tag" ; rdfs:subClassOf obo:MI_0507 . obo:MI_0522 obo:IAO_0000115 "The protein of interest is expressed as a fusion to the peptide EUKLISEED (a fragment of the Myc oncogene protein) for which antibodies are commercially available. Sometimes multiple copies of the peptide are fused in tandem." ; oboInOwl:hasExactSynonym "EUKLISEED epitope tag" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0522" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "myc tag" ; rdfs:subClassOf obo:MI_0507 . obo:MI_0523 obo:IAO_0000115 "The protein of interest is expressed as a fusion to the peptide MASMTGGQQMG for which antibodies are commercially available." ; oboInOwl:hasExactSynonym "MASMTGGQQMG epitope tag" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0523" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "t7 tag" ; rdfs:subClassOf obo:MI_0507 . obo:MI_0524 obo:IAO_0000115 "Tag encoding a calmodulin binding peptide, a TEV cleavage site, and the Staphylococcus aureus Protein A fused to a target protein. The tag allows two purification steps ensuring a highly selective purification of the tagged protein." ; oboInOwl:hasExactSynonym "CBP-ProtA tagged", "tap tagged" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0524" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "calmodulin binding peptide plus protein a tag" ; rdfs:subClassOf obo:MI_0677 . obo:MI_0525 obo:IAO_0000115 "The protein of interest is expressed as a fusion to the peptide GKPIPNPLLGLDST for which antibodies are commercially available." ; oboInOwl:hasExactSynonym "GKPIPNPLLGLDST epitope tag" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0525" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "v5 tag" ; rdfs:subClassOf obo:MI_0507 . obo:MI_0526 obo:IAO_0000115 """Residue modification. OBSOLETE remap to MOD:00723.""" ; oboInOwl:hasExactSynonym "acetyllysine" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0526" ; a owl:Class ; rdfs:label "n-acetyl-lysine" ; owl:deprecated true . obo:MI_0527 obo:IAO_0000115 """Residue modification. OBSOLETE remap to MOD:00752.""" ; oboInOwl:hasExactSynonym "adp-ribosylated" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0527" ; a owl:Class ; rdfs:label "adp ribosylated residue" ; owl:deprecated true . obo:MI_0528 obo:IAO_0000115 """Residue modification. OBSOLETE remap to MOD:00177.""" ; oboInOwl:hasExactSynonym "(S)-2-amino-5-([imino([adenosine 5'-(trihydrogen diphosphate) 5'->5'-ester with alpha-D-ribofuranosyl]amino)methyl]amino)pentanoic acid", "N(omega)-[alpha-D-ribofuranoside 5'->5'-ester with adenosine 5'-(trihydrogen diphosphate)]-L-arginine", "N(omega)-alpha-D-ribofuranosyl-L-arginine 5'->5'-ester with adenosine 5'-(trihydrogen diphosphate)", "adp-ribosylarginine", "omega-N-(ADP-ribosyl)-L-arginine" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0528" ; a owl:Class ; rdfs:label "omega-n-(adp-ribosyl)-arginine" ; owl:deprecated true . obo:MI_0529 obo:IAO_0000115 """Residue modification. OBSOLETE remap to MOD:00178.""" ; oboInOwl:hasExactSynonym "(R)-2-amino-3-([adenosine 5'-(trihydrogen diphosphate) 5'->5'-ester with alpha-D-ribofuranosyl]sulfanyl)propanoic acid", "S-(ADP-ribosyl)-L-cysteine", "S-L-cysteine alpha-D-ribofuranoside 5'->5'-ester with adenosine 5'-(trihydrogen diphosphate)", "S-alpha-D-ribofuranosyl-L-cysteine 5'->5'-ester with adenosine 5'-(trihydrogen diphosphate)", "adp-ribosylcysteine" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0529" ; a owl:Class ; rdfs:label "s-(adp-ribosyl)-cysteine" ; owl:deprecated true . obo:MI_0530 obo:IAO_0000115 """Residue modification. OBSOLETE remap to MOD:00300.""" ; oboInOwl:hasExactSynonym "(S)-2-amino-5-poly[2'-adenosine 5'-(trihydrogen diphosphate) 5'->5'-ester with 1alpha-D-ribofuranosyl]oxy-5-oxopentanoic acid", "L-glutamyl-5-poly(ADP-ribose)", "L-isoglutamyl-poly(ADP-ribose)", "adp-ribosylglutamate" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0530" ; a owl:Class ; rdfs:label "glutamyl-5-poly(adp-ribose)" ; owl:deprecated true . obo:MI_0531 obo:IAO_0000115 """Residue modification. OBSOLETE remap to MOD:00242.""" ; oboInOwl:hasExactSynonym "(S)-2-amino-3-([adenosine 5'-(trihydrogen diphosphate) 5'->5'-ester with alpha-D-ribofuranosyl]oxy)-propanoic acid Formula", "O-(ADP-ribosyl)-L-serine", "O3-(ADP-ribosyl)-L-serine", "O3-[alpha-D-ribofuranoside 5'->5'-ester with adenosine 5'-(trihydrogen diphosphate)]-L-serine", "O3-alpha-D-ribofuranosyl-L-serine 5'->5'-ester with adenosine 5'-(trihydrogen diphosphate)", "adp-ribosylserine" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0531" ; a owl:Class ; rdfs:label "o-(adp-ribosyl)-serine" ; owl:deprecated true . obo:MI_0532 obo:IAO_0000115 """Residue modification. OBSOLETE remap to MOD:00236.""" ; oboInOwl:hasExactSynonym "(S)-2-amino-4-([adenosine 5'-(trihydrogen diphosphate) 5'->5'-ester with alpha-D-ribofuranosyl]amino)-4-oxobutanoic acid", "N4-(ADP-ribosyl)-L-asparagine", "N4-[alpha-D-ribofuranoside 5'->5'-ester with adenosine 5'-(trihydrogen diphosphate)]-L-asparagine", "N4-alpha-D-ribofuranosyl-L-asparagine 5'->5'-ester with adenosine 5'-(trihydrogen diphosphate)", "adpribosylasparagine" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0532" ; a owl:Class ; rdfs:label "n4-(adp-ribosyl)-asparagine" ; owl:deprecated true . obo:MI_0533 obo:IAO_0000115 """Residue modification. OBSOLETE remap to MOD:00693.""" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0533" ; a owl:Class ; rdfs:label "glycosylated residue" ; owl:deprecated true . obo:MI_0534 obo:IAO_0000115 """Residue modification. OBSOLETE remap to MOD:00131.""" ; oboInOwl:hasExactSynonym "S-glycosyl-L-cysteine" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0534" ; a owl:Class ; rdfs:label "glycosyl-cysteine" ; owl:deprecated true . obo:MI_0535 obo:IAO_0000115 """Residue modification. OBSOLETE remap to MOD:00163.""" ; oboInOwl:hasExactSynonym "O-glycosyl-L-serine", "O3-glycosyl-L-serine" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0535" ; a owl:Class ; rdfs:label "glycosyl-serine" ; owl:deprecated true . obo:MI_0536 obo:IAO_0000115 """Residue modification. OBSOLETE remap to MOD:00164.""" ; oboInOwl:hasExactSynonym "O-glycosyl-L-threonine", "O3-glycosyl-L-threonine" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0536" ; a owl:Class ; rdfs:label "glycosyl-threonine" ; owl:deprecated true . obo:MI_0537 obo:IAO_0000115 """Residue modification. OBSOLETE remap to MOD:00332.""" ; oboInOwl:hasExactSynonym "glycosylarginine", "omega-N-glycosyl-L-arginine" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0537" ; a owl:Class ; rdfs:label "omega-n-glycosyl-arginine" ; owl:deprecated true . obo:MI_0538 obo:IAO_0000115 """Residue modification. OBSOLETE remap to MOD:00160.""" ; oboInOwl:hasExactSynonym "N4-glycosyl-L-asparagine", "glycosylasparagine" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0538" ; a owl:Class ; rdfs:label "n4-glycosyl-asparagine" ; owl:deprecated true . obo:MI_0539 obo:IAO_0000115 """Residue modification. OBSOLETE remap to MOD:00818.""" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0539" ; a owl:Class ; rdfs:label "gpi anchor residue" ; owl:deprecated true . obo:MI_0540 obo:IAO_0000115 """Residue modification. OBSOLETE remap to MOD:00172.""" ; oboInOwl:hasExactSynonym "N-alanyl-glycosylphosphatidylinositolethanolamine", "gpi-alanine" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0540" ; a owl:Class ; rdfs:label "gpi-anchor amidated alanine" ; owl:deprecated true . obo:MI_0541 obo:IAO_0000115 """Residue modification. OBSOLETE remap to MOD:00167.""" ; oboInOwl:hasExactSynonym "N-asparaginyl-glycosylphosphatidylinositolethanolamine", "gpi-asparagine" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0541" ; a owl:Class ; rdfs:label "gpi-anchor amidated asparagine" ; owl:deprecated true . obo:MI_0542 obo:IAO_0000115 """Residue modification. OBSOLETE remap to MOD:00168.""" ; oboInOwl:hasExactSynonym "N-aspartyl-glycosylphosphatidylinositolethanolamine", "gpi-aspartate" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0542" ; a owl:Class ; rdfs:label "gpi-anchor amidated aspartate" ; owl:deprecated true . obo:MI_0543 obo:IAO_0000115 """Residue modification. OBSOLETE remap to MOD:00169.""" ; oboInOwl:hasExactSynonym "N-cysteinyl-glycosylphosphatidylinositolethanolamine", "gpi-cysteine" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0543" ; a owl:Class ; rdfs:label "gpi-anchor amidated cysteine" ; owl:deprecated true . obo:MI_0544 obo:IAO_0000115 """Residue modification. OBSOLETE remap to MOD:00170.""" ; oboInOwl:hasExactSynonym "N-glycyl-glycosylphosphatidylinositolethanolamine", "gpi-glycine" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0544" ; a owl:Class ; rdfs:label "gpi-anchor amidated glycine" ; owl:deprecated true . obo:MI_0545 obo:IAO_0000115 """Residue modification. OBSOLETE remap to MOD:00171.""" ; oboInOwl:hasExactSynonym "N-seryl-glycosylphosphatidylinositolethanolamine", "gpi-serine" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0545" ; a owl:Class ; rdfs:label "gpi-anchor amidated serine" ; owl:deprecated true . obo:MI_0546 obo:IAO_0000115 """Residue modification. OBSOLETE remap to MOD:00173.""" ; oboInOwl:hasExactSynonym "N-threonyl-glycosylphosphatidylinositolethanolamine", "gpi-threonine" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0546" ; a owl:Class ; rdfs:label "gpi-anchor amidated threonine" ; owl:deprecated true . obo:MI_0547 obo:IAO_0000115 """Residue modification. OBSOLETE remap to MOD:01110.""" ; oboInOwl:hasExactSynonym "prenylcysteine" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0547" ; a owl:Class ; rdfs:label "s-prenyl-cysteine" ; owl:deprecated true . obo:MI_0548 obo:IAO_0000115 """Residue modification. OBSOLETE remap to MOD:00663.""" ; oboInOwl:hasExactSynonym "methylatedlysine" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0548" ; a owl:Class ; rdfs:label "methylated-lysine" ; owl:deprecated true . obo:MI_0549 obo:IAO_0000115 """Artificial residue modification enabling studies of cysteine binding status. OBSOLETE remap to MOD:00660.""" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0549" ; a owl:Class ; rdfs:label "alkylated cysteine" ; owl:deprecated true . obo:MI_0550 obo:IAO_0000115 """Residue modification. OBSOLETE remap to MOD:00041.""" ; oboInOwl:hasExactSynonym "(S)-3-amino-1,1,3-propanetricarboxylic acid", "1-carboxyglutamic acid [misnomer]", "4-carboxyglutamic acid", "L-gamma-carboxyglutamic acid", "carboxyglutamic acid" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0550" ; a owl:Class ; rdfs:label "gamma-carboxyglutamic acid" ; owl:deprecated true . obo:MI_0551 obo:IAO_0000115 """Residue modification. OBSOLETE remap to MOD:00461.""" ; oboInOwl:hasExactSynonym "nitrated tyrosine" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0551" ; a owl:Class ; rdfs:label "nitro-tyrosine" ; owl:deprecated true . obo:MI_0552 obo:IAO_0000115 """Residue modification. OBSOLETE remap to MOD:00235.""" ; oboInOwl:hasExactSynonym "(R)-2-amino-3-nitrososulfanyl-propanoic acid", "L-cysteine nitrite ester", "S-nitrosocysteine", "S-nitrosyl-L-cysteine", "nitrosylcysteine" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0552" ; a owl:Class ; rdfs:label "s-nitrosyl-cysteine" ; owl:deprecated true . obo:MI_0553 obo:IAO_0000115 """Residue modification. OBSOLETE remap to MOD:00181.""" ; oboInOwl:hasExactSynonym "(S)-2-amino-3-(4-sulfooxyphenyl)propanoic acid", "2-amino-3-(4-hydroxyphenyl)propanoic acid 4'-sulfate", "O4'-sulfo-L-tyrosine", "O4-sulfotyrosine", "sulfotyrosine", "tyrosine sulfate" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0553" ; a owl:Class ; rdfs:label "o4'-sulfo-tyrosine" ; owl:deprecated true . obo:MI_0554 obo:IAO_0000115 """Residue modification due to a cross-link between a lysine and a glycine from the sumo (Small Ubiquitin-related MOdifier) protein. OBSOLETE remap to MOD:01149.""" ; oboInOwl:hasExactSynonym "(S)-2-amino-6-[(aminoacetyl)amino]hexanoic acid", "N6-glycyl-L-lysine", "N6-glycyllysine" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0554" ; a owl:Class ; rdfs:label "sumoylated lysine" ; owl:deprecated true . obo:MI_0555 obo:IAO_0000115 """Residue modification. OBSOLETE remap to MOD:00890.""" ; oboInOwl:hasExactSynonym "phosphoshistidine" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0555" ; a owl:Class ; rdfs:label "phospho-histidine" ; owl:deprecated true . obo:MI_0556 obo:IAO_0000115 "Gln-Lys cross-link catalyzed by a transglutaminase." ; oboInOwl:hasExactSynonym "transglutamination" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0556" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "transglutamination reaction" ; rdfs:subClassOf obo:MI_0195 . obo:MI_0557 obo:IAO_0000115 "Involves the addition of one or more ADP-ribose moieties to proteins. Reaction that can affect Arg, Cys, Glu, Arg and Asn residues." ; oboInOwl:hasExactSynonym "adp ribosylation" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0557" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "adp ribosylation reaction" ; rdfs:subClassOf obo:MI_0414 . obo:MI_0558 obo:IAO_0000115 "Reaction catalyzed by PNGase, a deglycosylating enzyme that promotes the hydrolysis of the beta-aspartylglycosylamine bond of aspargine-linked glycopeptides and glycoproteins." ; oboInOwl:hasExactSynonym "deglycosylation" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0558" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "deglycosylation reaction" ; rdfs:subClassOf obo:MI_0414 . obo:MI_0559 obo:IAO_0000115 "The covalent attachment of a glycosyl residue to one or more monomeric units in a polypeptide, polynucleotide, polysaccharide, or other biological polymer. Reaction that can affect Ser, Thr, Cys, Arg, and Asn residues. This reaction is known to be reversible in the case of Asn substrate." ; oboInOwl:hasExactSynonym "glycosylation" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0559" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "glycosylation reaction" ; rdfs:subClassOf obo:MI_0414 . obo:MI_0560 obo:IAO_0000115 """Residue modification. OBSOLETE remap to MOD:00438.""" ; oboInOwl:hasExactSynonym "myristoylated aa" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0560" ; a owl:Class ; rdfs:label "myristoylated residue" ; owl:deprecated true . obo:MI_0561 obo:IAO_0000115 """Residue modification. OBSOLETE remap to MOD:00440.""" ; oboInOwl:hasExactSynonym "palmitoylated aa" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0561" ; a owl:Class ; rdfs:label "palmitoylated residue" ; owl:deprecated true . obo:MI_0562 obo:IAO_0000115 """Residue modification. OBSOLETE remap to MOD:00665.""" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0562" ; a owl:Class ; rdfs:label "methylated alanine" ; owl:deprecated true . obo:MI_0563 obo:IAO_0000115 """Residue modification. OBSOLETE remap to MOD:00658.""" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0563" ; a owl:Class ; rdfs:label "methylated arginine" ; owl:deprecated true . obo:MI_0564 obo:IAO_0000115 """Residue modification. OBSOLETE remap to MOD:00078.""" ; oboInOwl:hasExactSynonym "(S)-2-amino-5-[(imino(methylamino)methyl)amino]pentanoic acid", "NG-methylarginine;", "methylarginine", "omega-N-methyl-L-arginine" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0564" ; a owl:Class ; rdfs:label "omega-n-methyl-arginine" ; owl:deprecated true . obo:MI_0565 obo:IAO_0000115 """Residue modification due to a cross-link between a lysine and a glycine from the Nedd8 protein family. OBSOLETE remap to MOD:01150.""" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0565" ; a owl:Class ; rdfs:label "neddylated lysine" ; owl:deprecated true . obo:MI_0566 obo:IAO_0000115 "Reversible reaction that create a covalent bond between a C-terminus G of an ubiquitine like sumo protein and a K residue of the target." ; oboInOwl:hasExactSynonym "sumoylation" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0566" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "sumoylation reaction" ; rdfs:subClassOf obo:MI_0414 . obo:MI_0567 obo:IAO_0000115 "Reversible reaction that create a covalent bond between a Glycine residue of an ubiquitine like NEDD8 protein and a lysine residue of the target." ; oboInOwl:hasExactSynonym "neddylation" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0567" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "neddylation reaction" ; rdfs:subClassOf obo:MI_0414 . obo:MI_0568 obo:IAO_0000115 "Cleavage of the G-K bond and release of the SUMO ubiquitin like proteins." ; oboInOwl:hasExactSynonym "desumoylation" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0568" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "desumoylation reaction" ; rdfs:subClassOf obo:MI_0414 . obo:MI_0569 obo:IAO_0000115 "Cleavage of the G-K bond and release of the NEDD8 ubiquitin like proteins. Deneddylation, which removes the NEDD8 moiety, requires the isopeptidase activity of the COP9 signalosome." ; oboInOwl:hasExactSynonym "deneddylation" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0569" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "deneddylation reaction" ; rdfs:subClassOf obo:MI_0414 . obo:MI_0570 obo:IAO_0000115 "Covalent modification of a polypeptide occuring during its maturation or its proteolytic degradation." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0570" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "protein cleavage" ; rdfs:subClassOf obo:MI_0194 . obo:MI_0571 obo:IAO_0000115 "Any process by which a pre-mRNA or mRNA molecule is cleaved at specific sites or in a regulated manner." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0571" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "mrna cleavage" ; rdfs:subClassOf obo:MI_0902 . obo:MI_0572 obo:IAO_0000115 "Covalent bond breakage of a DNA molecule leading to the formation of smaller fragments." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0572" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "dna cleavage" ; rdfs:subClassOf obo:MI_0910 . obo:MI_0573 obo:IAO_0000115 "Region of a molecule whose mutation or deletion totally disrupts an interaction strength or rate (in the case of interactions inferred from enzymatic reaction).." ; oboInOwl:hasExactSynonym "mutation disrupting" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0573" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "mutation disrupting interaction" ; rdfs:subClassOf obo:MI_0119 . obo:MI_0574 obo:IAO_0000115 "Identifier of a publication prior to pubmed indexing." ; oboInOwl:hasDbXref "id-validation-regexp:", "search-url:" ; oboInOwl:hasExactSynonym "doi" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0574" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "digital object identifier" ; rdfs:subClassOf obo:MI_0445 . obo:MI_0575 obo:IAO_0000115 """Alliance for Cellular Signaling (AfCS -Nature) store yeast 2-hybrid Interaction data and expression data. Information and data are freely available to all. http://www.signaling-gateway.org""" ; oboInOwl:hasDbXref "id-validation-regexp:", "search-url:" ; oboInOwl:hasExactSynonym "AfCS", "afcs" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0575" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "alliance for cellular signaling" ; rdfs:subClassOf obo:MI_0461, obo:MI_0489 . obo:MI_0576 obo:IAO_0000115 "Method to identify domain-domain interactions within the same resolved structure. Domains are first projected onto a pdb structure and then the distance between all pairs of residues in different domains are calculated. When the distance between 2 residues is below the non covalent bond threshold, the corresponding pair of domains is predicted to interact." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0576" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "structural proximity" ; rdfs:subClassOf obo:MI_0577 . obo:MI_0577 obo:IAO_0000115 "Group of method taking advantage of 3D structure to calculate and infer the feature of interacting molecules." ; oboInOwl:hasExactSynonym "feature struct pred" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0577" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "feature prediction from structure" ; rdfs:subClassOf obo:MI_0660 . obo:MI_0578 obo:IAO_0000115 "The protein is expressed and purified as a fusion to the glutathione maltose-binding protein (MBP). The MBP-fusion protein can be purified by affinity chromatography using an amylose resin." ; oboInOwl:hasExactSynonym "maltose binding protein tag", "mbp tag" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0578" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "maltose binding protein tag" ; rdfs:subClassOf obo:MI_0240 . obo:MI_0579 obo:IAO_0000115 "Any molecule that is able to transfer an electron to another chemical species." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0579" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "electron donor" ; rdfs:subClassOf obo:MI_0918 . obo:MI_0580 obo:IAO_0000115 "Molecule to which an electron may be transferred from an electron donor." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0580" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "electron acceptor" ; rdfs:subClassOf obo:MI_0919 . obo:MI_0581 obo:IAO_0000115 "A gene whose genetic perturbation suppresses the phenotype resulting from a different genetic perturbation." ; oboInOwl:hasExactSynonym "suppressor" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0581" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "suppressor gene" ; rdfs:subClassOf obo:MI_0495 . obo:MI_0582 obo:IAO_0000115 "A gene whose genetic perturbation phenotype is suppressed by a different genetic perturbation." ; oboInOwl:hasExactSynonym "suppressed" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0582" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "suppressed gene" ; rdfs:subClassOf obo:MI_0495 . obo:MI_0583 obo:IAO_0000115 "Fluorophore which emits electromagnetic radiation of given wavelength." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0583" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "fluorescence donor" ; rdfs:subClassOf obo:MI_2334 . obo:MI_0584 obo:IAO_0000115 "Fluorophore able to absorb the electromagnetic radiation at given wavelength from a specific donor fluorophore, then re-emiting its own characteristic fluorescence." ; oboInOwl:hasExactSynonym "fluorescence accept" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0584" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "fluorescence acceptor" ; rdfs:subClassOf obo:MI_2335 . obo:MI_0585 obo:IAO_0000115 """IntEnz is the name for the Integrated relational Enzyme database and is the official version of the Enzyme Nomenclature. The Enzyme Nomenclature comprises recommendations of the Nomenclature Committee of the International Union of Bio chemistry and Molecular Biology (NC-IUBMB) on the nomenclature and classification of enzyme-catalysed reactions. IntEnz is supported by NC-IUBMB and contains enzyme data curated and approved by this committee. The database IntEnz is available at. http://www.ebi.ac.uk/intenz""" ; oboInOwl:hasDbXref "id-validation-regexp:", "search-url:" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0585" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "intenz" ; rdfs:subClassOf obo:MI_0461 . obo:MI_0586 obo:IAO_0000115 "Molecule inhibiting an interaction by interacting with one or more of its participants." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0586" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "inhibitor" ; rdfs:subClassOf obo:MI_2274 . obo:MI_0587 obo:IAO_0000115 """Molecule being identified as target of an inhibitor. OBSOLETE as term is deprecated to describe the target of an inhibitor that can have any other biological role.""" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0587" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "inhibited" ; owl:deprecated true . obo:MI_0588 obo:IAO_0000115 "Group of methods based on complementation assay where a third participant is shown to be necessary for the binding of a given bait prey pair. The molecule fused to the DNA binding domain is the bait, that fused to the transcriptional activator is the prey." ; oboInOwl:hasExactSynonym "3 hybrid", "3-hybrid", "tri hybrid", "tri-hybrid assay" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0588" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "three hybrid" ; rdfs:subClassOf obo:MI_0232 . obo:MI_0589 obo:IAO_0000115 "Protein sample collected by in vitro translation of its mRNA taking advantage of purified translation machinery." ; oboInOwl:hasExactSynonym "in vitro translated" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0589" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "in vitro translated protein" ; rdfs:subClassOf obo:MI_0342 . obo:MI_0590 obo:IAO_0000115 "Collection of topics describing the free text stored as an attribute value." ; oboInOwl:hasExactSynonym "CvTopic" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0590" ; oboInOwl:inSubset mi:Drugable, mi:PSI-MI_slim ; a owl:Class ; rdfs:label "attribute name" ; rdfs:subClassOf obo:MI_0000 . obo:MI_0591 obo:IAO_0000115 "The experimental condition text description, should contain information about the organisms hosting the interaction." ; oboInOwl:hasExactSynonym "experiment descripti" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0591" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "experiment description" ; rdfs:subClassOf obo:MI_0665 . obo:MI_0592 obo:IAO_0000115 """Web resource that allows the investigation of protein interactions in the Protein Data Bank structures at the level of Pfam domains and amino acid residues. iPfam is available on the Web for browsing at. http://www.sanger.ac.uk/Software/Pfam/iPfam/""" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0592" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "ipfam" ; rdfs:subClassOf obo:MI_0447 . obo:MI_0593 obo:IAO_0000115 "Xref pointing to a GO process term describing the start and end location of a migrating molecule, for instance see GO:0006611, 'protein-nucleus export'." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0593" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "translocation" ; rdfs:subClassOf obo:MI_0353 . obo:MI_0594 obo:IAO_0000115 "Xref pointing to a GO compartment term describing the start location of a migrating molecule." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0594" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "translocation start" ; rdfs:subClassOf obo:MI_0593 . obo:MI_0595 obo:IAO_0000115 "Xref pointing to a GO compartment term describing the end location of a migrating molecule." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0595" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "translocation end" ; rdfs:subClassOf obo:MI_0593 . obo:MI_0596 obo:IAO_0000115 "Free text description of all the tags and artificial process undergone by a molecule during an experiment." ; oboInOwl:hasExactSynonym "experimental form de" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0596" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "experimental form description" ; rdfs:subClassOf obo:MI_0666 . obo:MI_0597 obo:IAO_0000115 "The feature text description may include information about the feature detection method." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0597" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "feature description" ; rdfs:subClassOf obo:MI_0668 . obo:MI_0598 obo:IAO_0000115 "The feature constraint free text will specificity whether a biological feature is shown to be possible (just observed) or required (experimentally demonstrated to be necessary for an interaction)." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0598" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "feature constraint" ; rdfs:subClassOf obo:MI_0668 . obo:MI_0599 obo:IAO_0000115 "Text pointing to a specific paper figure legend where the experimental evidences for an interaction are to be found." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0599" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "figure legend" ; rdfs:subClassOf obo:MI_0664, obo:MI_0665 . obo:MI_0600 obo:IAO_0000115 """Two silent mutations show a nutrition sensitive lethal phenotype when they co-occur on the same cell. OBSOLETE: remap to CV intraction type 'synthetic interaction' MI:0794 and external CV for phenotype description.""" ; oboInOwl:hasExactSynonym "nutrition synt letal" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0600" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "conditional synthetic lethal nutrition-sensitivity" ; owl:deprecated true . obo:MI_0601 obo:IAO_0000115 "The Sequence Ontology (SO) is a structured controlled vocabulary for the parts of a genomic annotation. SO provides a common set of terms and definitions that will facilitate the exchange, analysis and management of genomic data." ; oboInOwl:hasDbXref "id-validation-regexp:" ; oboInOwl:hasExactSynonym "so" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0601" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "sequence ontology" ; rdfs:subClassOf obo:MI_0447, obo:MI_0473 . obo:MI_0602 obo:IAO_0000115 "Binding sites are identified by altered reactivity of a complex to a chemical treatment compared to the unbound molecules. Residues in close contact with the binding partner are protected from chemical modification. When these chemicals are administrated to intact cells, the pattern of protection from the probes identifies the location of DNA-protein or protein-protein interactions in vivo." ; oboInOwl:hasExactSynonym "chemical footprint" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0602" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "chemical footprinting" ; rdfs:subClassOf obo:MI_0417 . obo:MI_0603 obo:IAO_0000115 "Dimethylsulphate (DMS) is the most commonly used chemical to study DNA-protein interactions. DMS induces methylation of guanine residues so DNA interaction with protein binding to AT rich sequences or to the phosphate backbone may be not detected by DMS footprinting. However as DMS diffuses across membrane it can also be used for in vivo footprinting. The experiment involves the treatment with DMS of two DNA samples with identical sequence, one protein bound and the other naked. The two samples are treated with piperidine to induce chemical cleavage of the DMS modified guanine residues followed by digestion with restriction enzymes. Once labelled the samples are run in parallel on a gel to visualize the pattern of nested fragments sharing a common end generated by restriction enzyme(or PCR primer extension) and a variable end guanine dependent. The missing bands of the protein bound sample correspond to the guanine residues protected from modification by an interaction." ; oboInOwl:hasExactSynonym "dms footprinting" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0603" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "dimethylsulphate footprinting" ; rdfs:subClassOf obo:MI_0602 . obo:MI_0604 obo:IAO_0000115 "Potassium permanganate bind to single-stranded pyrimidine residues, it is commonly used to detect promoters opening regions in vivo. KMnO4 treatment of cells, followed by treatment with piperidine, followed by either PCR and/or acrylamide gel electrophoresis allows detection of interaction between transcription factor and the DNA sequence under their control." ; oboInOwl:hasExactSynonym "k-mn-04 footprinting" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0604" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "potassium permanganate footprinting" ; rdfs:subClassOf obo:MI_0602 . obo:MI_0605 obo:IAO_0000115 "Binding sites are identified by altered reactivity of a complex to an enzymatic probe compared to the unbound molecules. Residues in close contact with the binding partner are protected from cleavage by the enzyme. When these enzymes are administrated to intact cells, the pattern of protection from the probes identifies the location of DNA-protein or protein-protein interactions in vivo." ; oboInOwl:hasExactSynonym "enzymatic footprint" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0605" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "enzymatic footprinting" ; rdfs:subClassOf obo:MI_0417 . obo:MI_0606 obo:IAO_0000115 "Deoxyribonuclease I (DNase I) does not have high specificity for given sequences or residues, thus footprinting with DNase I permits the exact delineation of the protein-DNA binding site. Moreover DNase I, can be used for in vivo footprinting by treating intact cells with permeabilising drugs. In this latter case DNase I in vivo footprinting allow studies of the chromatin structure in genomic DNA." ; oboInOwl:hasExactSynonym "dnase 1 footprinting" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:hasRelatedSynonym "DNase I protection" ; oboInOwl:id "MI:0606" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "DNase I footprinting" ; rdfs:subClassOf obo:MI_1183 . obo:MI_0607 obo:IAO_0000115 "These RNA molecules are relatively short (less than 200 nucleotides each), and there are five of them (U1, U2, U4, U5, and U6) involved in the major form of pre-mRNA splicing. Known as snRNAs (small nuclear RNAs), each is complexed with at least seven protein subunits to form a snRNP (small nuclear ribonucleoprotein). These snRNPs form the core of the spliceosome." ; oboInOwl:hasExactSynonym "snRNA", "snrna" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0607" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "small nuclear rna" ; rdfs:subClassOf obo:MI_0320 . obo:MI_0608 obo:IAO_0000115 "RNA that is transcribed from the DNA of the nucleolus and is found, together with characteristic proteins, in the ribosomes." ; oboInOwl:hasExactSynonym "rRNA", "rrna" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0608" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "ribosomal rna" ; rdfs:subClassOf obo:MI_0320 . obo:MI_0609 obo:IAO_0000115 "The small nucleolar RNAs, are stable RNA contained in the nucleoli and these RNAs exist as snoRNA: protein complexes called snoRNPs (also called 'snorps'). The snoRNPs function is in the maturation of ribosomal RNA and other RNAs, by: creating two types of modified nucleotides, (2'-O-methylated nucleotides and pseudouridine), and mediating endonucleolytic cleavages of pre-rRNA." ; oboInOwl:hasExactSynonym "snoRNA", "snorna" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0609" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "small nucleolar rna" ; rdfs:subClassOf obo:MI_0320 . obo:MI_0610 obo:IAO_0000115 "Ribonucleic acid used in RNAi study. These RNA have the reverse complementary sequence of a target gene's mRNA transcript and inhibit its expression." ; oboInOwl:hasExactSynonym "dicer RNA", "micro RNA", "siRNA", "sirna" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0610" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "small interfering rna" ; rdfs:subClassOf obo:MI_0320 . obo:MI_0611 obo:IAO_0000115 "Small (300 nucleotides) stable RNAs transcribed by RNA pol III that are part of the signal-recognition particle (SRP). This particle comprises one RNA and six proteins bound to the RNA. SRP function is to assist secretory proteins sorting in the endoplasmic reticulum (ER). SRP is a cytosolic particle that transiently binds to the ER signal sequence of a nascent protein, to the large ribosomal unit, and to the SRP receptor in the ER membrane." ; oboInOwl:hasExactSynonym "srpRNA", "srprna" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0611" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "signal recognition particle rna" ; rdfs:subClassOf obo:MI_0320 . obo:MI_0612 obo:IAO_0000115 "Comment for public view. This attribute can be associated to interaction, experiment, CV term, an organism and any participant." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0612" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "comment" ; rdfs:subClassOf obo:MI_0664, obo:MI_0665, obo:MI_0666, obo:MI_0667, obo:MI_0668, obo:MI_0669 . obo:MI_0613 obo:IAO_0000115 "Biological function of a participant or of an interaction." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0613" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "function" ; rdfs:subClassOf obo:MI_0664, obo:MI_0666 . obo:MI_0614 obo:IAO_0000115 "URL/Web address describing an experiment, an interaction, a Cv term or an organism." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0614" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "url" ; rdfs:subClassOf obo:MI_0664, obo:MI_0665, obo:MI_0667, obo:MI_0669 . obo:MI_0615 obo:IAO_0000115 "Search engine URL associated to Cv Database terms." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0615" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "search-url" ; rdfs:subClassOf obo:MI_0667 . obo:MI_0616 obo:IAO_0000115 "Example generally associated to Cv terms. Test." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0616" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "example" ; rdfs:subClassOf obo:MI_0667, obo:MI_1041 . obo:MI_0617 obo:IAO_0000115 "The interaction has a known or demonstrated disease association." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0617" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "disease" ; rdfs:subClassOf obo:MI_0664 . obo:MI_0618 obo:IAO_0000115 "Warning about errors or grounds for confusion. Can be associated to an interaction, experiment, CV term or any participant." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0618" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "caution" ; rdfs:subClassOf obo:MI_0664, obo:MI_0665, obo:MI_0666, obo:MI_0667, obo:MI_0668, obo:MI_0669 . obo:MI_0619 obo:IAO_0000115 "Refers to the metabolic or signalling pathway involving an interaction or a complex." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0619" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "pathway" ; rdfs:subClassOf obo:MI_0664 . obo:MI_0620 obo:IAO_0000115 "Search URL to retrieve an external entry in ASCII format. Generally associated to Cv Database terms." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0620" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "search-url-ascii" ; rdfs:subClassOf obo:MI_0667 . obo:MI_0621 obo:IAO_0000115 "Confidence classification assigned by the author of the publication to a specific interaction." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0621" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "author-confidence" ; rdfs:subClassOf obo:MI_0664 . obo:MI_0622 obo:IAO_0000115 "Description of confidence assessment method generally associated to the experiment." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0622" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "confidence-mapping" ; rdfs:subClassOf obo:MI_0665 . obo:MI_0623 obo:IAO_0000115 "The interaction between the proteins or the formation of a complex is disrupted by a biological molecule or by a modification of the interactors." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0623" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "inhibition" ; rdfs:subClassOf obo:MI_0664 . obo:MI_0624 obo:IAO_0000115 "Reaction occurs at a faster rate in the presence of this compound or molecule i.e. the molecule directly physically co-operates with the interaction. Reaction may not occur at all in the absence of this molecule." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0624" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "stimulant" ; rdfs:subClassOf obo:MI_0664 . obo:MI_0625 obo:IAO_0000115 "Any chemical applied externally to cells or any type of environmental condition, such as hypoxia, that stimulates an interaction, potentially by causing modification of one or more of the interactors." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0625" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "agonist" ; rdfs:subClassOf obo:MI_0664 . obo:MI_0626 obo:IAO_0000115 "Any chemical applied externally to cells or any type of environmental condition, such as hypoxia, that inhibits an interaction, potentially by alteration of amount or binding affinity of one or more of the interactors." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0626" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "antagonist" ; rdfs:subClassOf obo:MI_0664 . obo:MI_0627 obo:IAO_0000115 "Modifications of the standard experimental method described in the CV." ; oboInOwl:hasExactSynonym "exp-modification" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0627" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "experiment modification" ; rdfs:subClassOf obo:MI_0665 . obo:MI_0628 obo:IAO_0000115 "Regular Expression used to check the validity of cross references' identifier. Attribute generally associated to terms in Cv Database." ; oboInOwl:hasExactSynonym "id-validation-regexp" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0628" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "validation regular expression" ; rdfs:subClassOf obo:MI_0667 . obo:MI_0629 obo:IAO_0000115 "Information on the complex being annotated. Attribute generally associated to an interaction." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0629" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "complex-properties" ; rdfs:subClassOf obo:MI_0664, obo:MI_0665 . obo:MI_0630 obo:IAO_0000115 "Comments on the 3D structure. This attribute is generally associated to an interaction." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0630" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "3d-structure" ; rdfs:subClassOf obo:MI_0664 . obo:MI_0631 obo:IAO_0000115 "Free R-Factor and working R-Factor for the quality of the crystallographic model. This attribute is generally associated to an interaction." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0631" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "3d-r-factors" ; rdfs:subClassOf obo:MI_0664 . obo:MI_0632 obo:IAO_0000115 "Resolution of the 3D structure. This attribute is generally associated to an interaction." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0632" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "3d-resolution" ; rdfs:subClassOf obo:MI_0664 . obo:MI_0633 obo:IAO_0000115 "Information about how the data was processed. This attribute is used mainly for large scale experiment." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0633" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "data-processing" ; rdfs:subClassOf obo:MI_0665 . obo:MI_0634 obo:IAO_0000115 "E-mail address to contact the author or organisation which has produced the data. This attribute is generally associated to an experiment." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0634" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "contact-email" ; rdfs:subClassOf obo:MI_1093 . obo:MI_0635 obo:IAO_0000115 "Free text notes on how to contact the author or organisation which has produced the data This attribute is generally associated to an experiment." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0635" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "contact-comment" ; rdfs:subClassOf obo:MI_1093 . obo:MI_0636 obo:IAO_0000115 "List of authors associated to a publication. This attribute is generally associated to an experiment." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0636" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "author-list" ; rdfs:subClassOf obo:MI_1093 . obo:MI_0637 obo:IAO_0000115 "Participant isoform's comment. This attribute can be attached to interactions or participants." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0637" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "isoform-comment" ; rdfs:subClassOf obo:MI_0664, obo:MI_0666 . obo:MI_0638 obo:IAO_0000115 "Post translational modification required for an interaction to occur." ; oboInOwl:hasExactSynonym "prerequisite ptm", "prerequisite-ptm", "required ptm", "required-ptm" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0638" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "prerequisite-ptm" ; rdfs:subClassOf obo:MI_0925 . obo:MI_0639 obo:IAO_0000115 "Post translational modification occurs subsequently to an interaction." ; oboInOwl:hasExactSynonym "resulting ptm", "resulting-ptm" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0639" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "resulting-ptm" ; rdfs:subClassOf obo:MI_0925 . obo:MI_0640 obo:IAO_0000115 "Parameter for enzymatic or binding kinetic studies." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0640" ; oboInOwl:inSubset mi:Drugable, mi:PSI-MI_slim ; a owl:Class ; rdfs:label "parameter type" ; rdfs:subClassOf obo:MI_0000 . obo:MI_0641 obo:IAO_0000115 "Molar concentration of an antagonist which produces 50% of the maximum possible inhibitory response for that antagonist. Note this measure depends on the specific antagonist used and upon experimental conditions, notably temperature, pH and solution composition (e.g., salts, chelating agents and others). Thus the ic50 is a relative measure and its values can be compared only when sharing the same experimental setting. Unit Molar." ; oboInOwl:hasExactSynonym "IC50" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0641" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "ic50" ; rdfs:subClassOf obo:MI_0640 . obo:MI_0642 obo:IAO_0000115 "Molar concentration of an agonist which produces 50% of the maximum possible response for that agonist. Note this measure depends on the specific agonist used and upon experimental conditions, notably temperature, pH and solution composition (e.g., salts, chelating agents and others). Thus the ec50 is a relative measure and its values can be compared only when sharing the same experimental setting. Unit Molar." ; oboInOwl:hasExactSynonym "EC50" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0642" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "ec50" ; rdfs:subClassOf obo:MI_0640 . obo:MI_0643 obo:IAO_0000115 "Equilibrium constant for dissociation of an inhibitor. Unit Molar." ; oboInOwl:hasExactSynonym "Ki" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0643" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "ki" ; rdfs:subClassOf obo:MI_0640 . obo:MI_0644 obo:IAO_0000115 "Michaelis-Menten constant: concentration of substrate at which the reaction rate is equal to half the maximal rate (i.e. Km={s} when Vo=1/2Vmax). Unit Molar." ; oboInOwl:hasExactSynonym "Km" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0644" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "km" ; rdfs:subClassOf obo:MI_0640 . obo:MI_0645 obo:IAO_0000115 "The number of substrate molecules converted to product in a given unit of time, on a single enzyme molecule when the enzyme is saturated with substrate. Unit per second, or s-1." ; oboInOwl:hasExactSynonym "turnover number" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0645" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "kcat" ; rdfs:subClassOf obo:MI_0640 . obo:MI_0646 obo:IAO_0000115 "The equilibrium dissociation constant of a receptor/ligand or proteinA/proteinB complex. Unit Molar (generally M-1)." ; oboInOwl:hasExactSynonym "Kd" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0646" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "Kd" ; rdfs:subClassOf obo:MI_0640 . obo:MI_0647 obo:IAO_0000115 "Controlled vocabulary for kinetic constant units." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0647" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "parameter unit" ; rdfs:subClassOf obo:MI_0000 . obo:MI_0648 obo:IAO_0000115 "Molarity is the number of moles of solute dissolved in one liter of solution. The units, therefore are moles per liter, specifically it's moles of solute per liter of solution. These units are abbreviated as M and it means moles per liter (not just moles)." ; oboInOwl:hasExactSynonym "M" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0648" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "molar" ; rdfs:subClassOf obo:MI_0647 . obo:MI_0649 obo:IAO_0000115 "The second is the duration of 9 192 631 770 periods of the radiation corresponding to the transition between the two hyperfine levels of the ground state of the cesium-133 atom. The second was originally defined as 1/86 400 mean solar day until astronomers discovered that the mean solar day is actually not constant." ; oboInOwl:hasExactSynonym "s", "sec" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0649" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "second" ; rdfs:subClassOf obo:MI_0647 . obo:MI_0650 obo:IAO_0000115 """10E-3 moles per liter of solution. OBSOLETE: term redundant with the schema exponent attribute of the parameter.""" ; oboInOwl:hasExactSynonym "mM" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0650" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "millimolar" ; owl:deprecated true . obo:MI_0651 obo:IAO_0000115 """10E-6 moles per liter of solution. OBSOLETE: term redundant with the schema exponent attribute of the parameter.""" ; oboInOwl:hasExactSynonym "uM" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0651" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "micromolar" ; owl:deprecated true . obo:MI_0652 obo:IAO_0000115 """10E-9 moles per liter of solution. OBSOLETE: term redundant with the schema exponent attribute of the parameter.""" ; oboInOwl:hasExactSynonym "nM" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0652" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "nanomolar" ; owl:deprecated true . obo:MI_0653 obo:IAO_0000115 """10E-12 moles per liter of solution. OBSOLETE: term redundant with the schema exponent attribute of the parameter.""" ; oboInOwl:hasExactSynonym "pM" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0653" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "picomolar" ; owl:deprecated true . obo:MI_0654 obo:IAO_0000115 """10E-15 moles per liter of solution. OBSOLETE: term redundant with the schema exponent attribute of the parameter.""" ; oboInOwl:hasExactSynonym "fM" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0654" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "fentomolar" ; owl:deprecated true . obo:MI_0655 obo:IAO_0000115 "A protein of interest (the bait) is fused to the full-length bacteriophage lambda repressor protein (lambdacI, 237 amino acids), containing the amino terminal DNA-binding domain and the carboxylterminal dimerization domain. The corresponding target (prey) protein is fused to the N-terminal domain of the alfa-subunit of RNA polymerase (248 amino acids). The bait is tethered to the lambda operator sequence upstream of the reporter promoter through the DNA-binding domain of lambdacI. When the bait and prey interact, they recruit and stabilize the binding of RNA polymerase at the promoter and activate the transcription of the HIS3 reporter gene. Due to the tendency of both the lambda repressor protein and the N-terminal domain of the alfa-subunit of RNA polymerase to dimerize, this system might not be optimal for the analysis of proteins that self-associate unless their interaction with other protein partners depends on the oligomerization." ; oboInOwl:hasExactSynonym "BacterioMatch", "lambda two hybrid" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0655" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "lambda repressor two hybrid" ; rdfs:subClassOf obo:MI_0232 . obo:MI_0656 obo:IAO_0000115 "Peptide whose sequence is experimentally identified and can lead to a full protein identification." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0656" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "identified peptide" ; rdfs:subClassOf obo:MI_0505 . obo:MI_0657 obo:IAO_0000115 "RNA and cDNA constructs with variable central sequences and a constant flanking region are collected in a complex library. The library is then screened to select either specific binding partners of a bait molecule (generally a protein) or particular enzymatic activities of the nucleic acid molecules themselves. The selected nucleic acids are amplified using the constant flanking regions to increase their abundance. Cycles of selection-amplification can be repeated to increase the specificity of the targets that, at the end, are individually identified by sequencing." ; oboInOwl:hasExactSynonym "in vitro evolution of nucleic acids", "selex" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0657" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "systematic evolution of ligands by exponential enrichment" ; rdfs:subClassOf obo:MI_0400 . obo:MI_0658 obo:IAO_0000115 "MudPIT is a method for rapid and large-scale protein identification by multidimensional liquid chromatography associated with tandem mass spectrometry. The chromatography step consists of strong cation exchange material back-to-back with reversed phase material inside fused silica capillaries. The peptides bound to the cation-exchange resin are freed by the gradually increasing salt concentration of the buffer and are subsequently retained by the reversed phase resin. Increasing buffers hydrophobicity progressively elute peptides from the reversed phase packing directly into the mass spectrometer. Typically this mass spectrometer will be a tandem electrospray, so peptides undergo ionization in the liquid phase, are separated in a primary mass spectrometer, analysed in the second mass spectrometer and identified." ; oboInOwl:hasExactSynonym "mudpit" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0658" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "multidimensional protein identification technology" ; rdfs:subClassOf obo:MI_0093, obo:MI_0427, obo:MI_0815 . obo:MI_0659 obo:IAO_0000115 "Experimental method by which a feature is detected or identified." ; oboInOwl:hasExactSynonym "exp feature detect" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0659" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "experimental feature detection" ; rdfs:subClassOf obo:MI_0003 . obo:MI_0660 obo:IAO_0000115 "Feature detection based on computational analysis." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0660" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "feature prediction" ; rdfs:subClassOf obo:MI_0003 . obo:MI_0661 obo:IAO_0000115 "experimental participant identification." ; oboInOwl:hasExactSynonym "experimental particp" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0661" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "experimental participant identification" ; rdfs:subClassOf obo:MI_0002 . obo:MI_0662 obo:IAO_0000115 """IMEx primary identifier that is assigned to an experiment record by the database that created the record in the context of IMEx consortium. The identifiers are unique across all member database as they are all generated by a centralized key-assigner. http://imex.sourceforge.net/""" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0662" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "imex-primary" ; rdfs:subClassOf obo:MI_0353 . obo:MI_0663 obo:IAO_0000115 "A confocal is a standard epifluorescence microscope with improvement essentially coming from the rejection of out-of-focus light interference. Confocal imaging system achieves this by two strategies: a) by illuminating a single point of the specimen at any one time with a focused beam, so that illumination intensity drops off rapidly and b) by the use of blocking a pinhole aperture in a conjugate focal plane to the specimen so that light emitted away from the point in the specimen being illuminated is blocked from reaching the detector. Only the light from the single point illuminated of the specimen passing through the image pinhole is detected by a photodetector. Usually a computer is used to control the sequential scanning of the sample and to assemble the image for display onto a video screen." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0663" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "confocal microscopy" ; rdfs:subClassOf obo:MI_0428 . obo:MI_0664 obo:IAO_0000115 "Attribute name of annotation associated to an interaction element." ; oboInOwl:hasExactSynonym "interaction att name" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0664" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "interaction attribute name" ; rdfs:subClassOf obo:MI_0590 . obo:MI_0665 obo:IAO_0000115 "Attribute name of annotation associated to an experiment element." ; oboInOwl:hasExactSynonym "experiment att name" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0665" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "experiment attribute name" ; rdfs:subClassOf obo:MI_0590 . obo:MI_0666 obo:IAO_0000115 "Attribute name of annotation associated to a participant element." ; oboInOwl:hasExactSynonym "participant att name" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0666" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "participant attribute name" ; rdfs:subClassOf obo:MI_0590 . obo:MI_0667 obo:IAO_0000115 "Attribute name of annotation associated to a CV term." ; oboInOwl:hasExactSynonym "cv att name" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0667" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "controlled vocabulary attribute name" ; rdfs:subClassOf obo:MI_0590 . obo:MI_0668 obo:IAO_0000115 "Attribute name of annotation associated to a feature element." ; oboInOwl:hasExactSynonym "feature att name" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0668" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "feature attribute name" ; rdfs:subClassOf obo:MI_0590 . obo:MI_0669 obo:IAO_0000115 "Attribute name of annotation associated to an organism element." ; oboInOwl:hasExactSynonym "organism att name" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0669" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "organism attribute name" ; rdfs:subClassOf obo:MI_0590 . obo:MI_0670 obo:IAO_0000115 "International Molecular Interaction Exchange." ; oboInOwl:hasDbXref "search-url:" ; oboInOwl:hasExactSynonym "IMEx" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0670" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "imex" ; rdfs:subClassOf obo:MI_0461 . obo:MI_0671 obo:IAO_0000115 "This annotation topic should contain information about antibodies when specific antibodies (monoclonal or polyclonal raised against specific regions of the proteins or purified in a specific manner) have been used." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0671" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "antibodies" ; rdfs:subClassOf obo:MI_0665 . obo:MI_0672 obo:IAO_0000115 "This annotation topic will be used to store information about the cDNA library. If a name is available this should be reported along with a short description of the library." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0672" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "library-used" ; rdfs:subClassOf obo:MI_0665 . obo:MI_0673 obo:IAO_0000115 "Alternative names to describe a complex." ; oboInOwl:hasExactSynonym "complex-synonym" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0673" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "complex synonym" ; rdfs:subClassOf obo:MI_1041 . obo:MI_0674 obo:IAO_0000115 "Describe a cross reference pointing to a peptide parent sequence." ; oboInOwl:hasExactSynonym "peptide-parent" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0674" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "peptide parent sequence reference" ; rdfs:subClassOf obo:MI_0353 . obo:MI_0675 obo:IAO_0000115 "IPI provides a top level guide to the main databases that describe the proteomes of higher eukaryotic organisms. IPI effectively maintains a database of cross references between the primary data sources, provides minimally redundant yet maximally complete sets of proteins for featured species (one sequence per transcript) and maintains stable identifiers (with incremental versioning) to allow the tracking of sequences in IPI between IPI releases. IPI is updated monthly in accordance with the latest data released by the primary data sources." ; oboInOwl:hasDbXref "id-validation-regexp:" ; oboInOwl:hasExactSynonym "ipi" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0675" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "international protein index" ; rdfs:subClassOf obo:MI_1096 . obo:MI_0676 obo:IAO_0000115 "Tandem affinity purification allows rapid purification under native conditions of complexes, even when expressed at their natural level. Prior knowledge of complex composition or function is not required. The TAP method requires fusion of the a multiple tag, either N- or C-terminally, to the target (or bait) protein of interest. The multiple tag allows two steps purification steps ensuring a highly selective complex purification." ; oboInOwl:hasExactSynonym "TAP", "tap" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0676" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "tandem affinity purification" ; rdfs:subClassOf obo:MI_0004 . obo:MI_0677 obo:IAO_0000115 "A tandem tag consists of the concatenation of simple distinct tags that is engineered to be cloned as a unique element onto a sequence of interest. Note that when a protein is fused to many simple tags that are inserted individually and possibly in different sequence positions these should be reported as independent features." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0677" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "tandem tag" ; rdfs:subClassOf obo:MI_0507 . obo:MI_0678 obo:IAO_0000115 "A microarray consisting of antibodies spotted on a solid support in appropriate orientation is incubated with a biological sample (or antigen). Some proteins are captured by the antibodies in the array. Protein of forming complexes on the array are identified according to their prior labelling (tag, ELISA, biotin and others)." ; oboInOwl:hasExactSynonym "antigen capture assay", "sandwich immunoassay" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0678" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "antibody array" ; rdfs:subClassOf obo:MI_0089 . obo:MI_0679 obo:IAO_0000115 "A sequence of adenine nucleotides that is added to the 3' end of some primary transcript messenger RNA molecules in eukaryotes during post-transcriptional processing. The added tail is believed to confer stability to the molecule." ; oboInOwl:hasExactSynonym "poly A", "poly a" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0679" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "poly adenine" ; rdfs:subClassOf obo:MI_0320 . obo:MI_0680 obo:IAO_0000115 "DNA that consists of only one chain of nucleotides rather than the two base pairing strands found in DNA in the double helix form." ; oboInOwl:hasExactSynonym "ss DNA", "ss dna" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0680" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "single stranded deoxyribonucleic acid" ; rdfs:subClassOf obo:MI_0319 . obo:MI_0681 obo:IAO_0000115 """DNA that consists of two base pairing strands. The 2 nucleotide chains are held together by hydrogen bonds between base pairs of nucleotides. """ ; oboInOwl:hasExactSynonym "ds DNA", "ds dna" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0681" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "double stranded deoxyribonucleic acid" ; rdfs:subClassOf obo:MI_0319 . obo:MI_0682 obo:IAO_0000115 "A cofactor is a small molecule required for the catalysis of an enzyme." ; oboInOwl:hasExactSynonym "coenzyme" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0682" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "cofactor" ; rdfs:subClassOf obo:MI_0500 . obo:MI_0683 obo:IAO_0000115 "Database collecting nucleic or amino acid sequences mainly derived from genomic or mRNA sequencing." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0683" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "sequence database" ; rdfs:subClassOf obo:MI_0473 . obo:MI_0684 obo:IAO_0000115 "Molecule required for an observed binary interaction to occur. This molecule may act as stabilizer of any of the interaction partners or may act as a bridge molecule between them but the method does not provide resolution or evidence to demonstrate its actual molecular function (i.e.Mudpit, tri hybrid etc)." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0684" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "ancillary" ; rdfs:subClassOf obo:MI_0495, obo:MI_0500 . obo:MI_0685 obo:IAO_0000115 "Publication or document describing the originating resource where an interaction, or other curated information, was first described." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0685" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "source reference" ; rdfs:subClassOf obo:MI_0353 . obo:MI_0686 obo:IAO_0000115 "Yet to be identified interaction detection method associated with interaction data imported from a third party database. This database may have potentially different standards of curation." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0686" ; oboInOwl:inSubset mi:Drugable, mi:PSI-MI_slim ; a owl:Class ; rdfs:label "unspecified method" ; rdfs:subClassOf obo:MI_0001 . obo:MI_0687 obo:IAO_0000115 "Protein having well characterized fluorescence excitation and emission spectra used as fusion with a protein under study to facilitate its localisation or identification." ; oboInOwl:hasExactSynonym "fluorescent prot tag" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0687" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "fluorescent protein tag" ; rdfs:subClassOf obo:MI_0240 . obo:MI_0688 obo:IAO_0000115 "Part of a transcription factor responsible for the binding of gene regulatory region prior to their transcription. Such tags are generally used in two hybrid experiments where they are fused to a bait polypeptide tested for its ability to interact with a prey fused to an activation domain tag." ; oboInOwl:hasExactSynonym "dna binding domain" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0688" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "dna binding domain tag" ; rdfs:subClassOf obo:MI_0240 . obo:MI_0689 obo:IAO_0000115 "Part of a transcription factor responsible for the activation of DNA transcription. Such tags are generally used in two hybrid experiments where they are fused to a prey polypeptide tested for its ability to interact with a bait fused to a DNA binding domain tag." ; oboInOwl:hasExactSynonym "activation domain" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0689" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "activation domain tag" ; rdfs:subClassOf obo:MI_0240 . obo:MI_0690 obo:IAO_0000115 "Part of the yeast transcription factor GAL4 (amino acids 766-881) specifically responsible for DNA transcription activation." ; oboInOwl:hasExactSynonym "gal4 ad" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0690" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "gal4 activation domain" ; rdfs:subClassOf obo:MI_0689 . obo:MI_0691 obo:IAO_0000115 "Full viral protein vp16 exclusively responsible for preferential transcriptional activation of viral genes. Activation requires the formation of a complex with the host cell transcription factor." ; oboInOwl:hasExactSynonym "vp16 ad" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0691" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "vp16 activation domain" ; rdfs:subClassOf obo:MI_0689 . obo:MI_0692 obo:IAO_0000115 "B42 is an acidic sequence of 89 residues derived from Escherichia coli acting as weak transcription activation domain. When use in two hybrid experiments, the weakness of B42 as activator increases the sensitivity of the interaction detection." ; oboInOwl:hasExactSynonym "b42 ad" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0692" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "b42 activation domain" ; rdfs:subClassOf obo:MI_0689 . obo:MI_0693 obo:IAO_0000115 """Part of the yeast transcription factor GAL4 (amino acids 11-38) specifically responsible for DNA binding of a 17 base-pair long sequence in the upstream activating sequence of galactose-induced genes. """ ; oboInOwl:hasExactSynonym "gal4 dna bd" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0693" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "gal4 dna binding domain" ; rdfs:subClassOf obo:MI_0688 . obo:MI_0694 obo:IAO_0000115 "Amino terminal (1-220) part of the Escherichia coli lexA repressor, binding to 16 base pair palindromic DNA sequences." ; oboInOwl:hasExactSynonym "lexa dna bd" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0694" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "lexa dna binding domain" ; rdfs:subClassOf obo:MI_0688 . obo:MI_0695 obo:IAO_0000115 "Antibody array where proteins retained by the arrayed antibodies are identified using a detector antibody. The detector antibody is either modified with a directly detectable label (enzyme, fluorescent molecule, isotope, etc.), or it is biotinylated for detection after subsequent probing with labeled streptavidin." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0695" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "sandwich immunoassay" ; rdfs:subClassOf obo:MI_0678 . obo:MI_0696 obo:IAO_0000115 "Measures the catalysis of the transfer of a free nucleotidyl group to a nucleic acid chain." ; oboInOwl:hasExactSynonym "nucleotidyltransferase assay" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0696" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "polymerase assay" ; rdfs:subClassOf obo:MI_0415 . obo:MI_0697 obo:IAO_0000115 "Measures the catalysis of the reaction: deoxynucleoside triphosphate + DNA(n) = diphosphate + DNA(n+1); the synthesis of DNA from deoxyribonucleotide triphosphates in the presence of a DNA template or primer." ; oboInOwl:hasExactSynonym "dna dna pol assay" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0697" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "dna directed dna polymerase assay" ; rdfs:subClassOf obo:MI_0696 . obo:MI_0698 obo:IAO_0000115 "Measures the catalysis of the reaction: nucleoside triphosphate + RNA(n) = diphosphate + RNA(n+1). Utilizes a DNA template, i.e. the catalysis of DNA-template-directed extension of the 3'-end of an RNA strand by one nucleotide at a time. Can initiate a chain 'de novo'." ; oboInOwl:hasExactSynonym "dna rna pol assay" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0698" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "dna directed rna polymerase assay" ; rdfs:subClassOf obo:MI_0696 . obo:MI_0699 obo:IAO_0000115 "Measures the catalysis of the reaction: deoxynucleoside triphosphate + DNA(n) = diphosphate + DNA(n+1). Catalyzes RNA-template-directed extension of the 3'- end of a DNA strand by one deoxynucleotide at a time." ; oboInOwl:hasExactSynonym "rna dna pol assay" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0699" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "rna directed dna polymerase assay" ; rdfs:subClassOf obo:MI_0696 . obo:MI_0700 obo:IAO_0000115 "Measures the catalysis of the reaction: nucleoside triphosphate + RNA (n) = diphosphate + RNA (n+1); uses an RNA template." ; oboInOwl:hasExactSynonym "rna rna pol assay" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0700" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "rna directed rna polymerase assay" ; rdfs:subClassOf obo:MI_0696 . obo:MI_0701 obo:IAO_0000115 "The process by which a DNA strand is synthesized from template DNA by the action of polymerases, which add nucleotides to the 3' end of the nascent DNA strand." ; oboInOwl:hasExactSynonym "DNA replication elongation ", "dna elongation" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0701" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "dna strand elongation" ; rdfs:subClassOf obo:MI_0986 . obo:MI_0702 obo:IAO_0000115 """The PANTHER (Protein ANalysis THrough Evolutionary Relationships) Classification System is a unique resource that classifies genes by their functions using published scientific experimental evidence and evolutionary relationships to predict function even in the absence of direct experimental evidence. www.pantherdb.org/""" ; oboInOwl:hasExactSynonym "PANTHER" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0702" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "panther" ; rdfs:subClassOf obo:MI_0449 . obo:MI_0703 obo:IAO_0000115 """The Gene3D database provides a combined structural, functional and evolutionary view of the protein world. It is focused on providing structural annotation for protein sequences without structural representatives--including the complete proteome sets of over 240 different species. http://cathwww.biochem.ucl.ac.uk:8080/Gene3D/""" ; oboInOwl:hasExactSynonym "Gene3D" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0703" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "gene3d" ; rdfs:subClassOf obo:MI_0449 . obo:MI_0704 obo:IAO_0000115 "Method by which nucleic acids are delivered or engineered into a cell." ; oboInOwl:hasExactSynonym "nucl delivery" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0704" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "nucleic acid delivery" ; rdfs:subClassOf obo:MI_0307 . obo:MI_0705 obo:IAO_0000115 "Western blot assay performed when specific antibodies for the protein of interest are not available. Therefore the protein is expressed as a hybrid protein fused to a tag for which efficient antibodies are available. The antibody may be either monoclonal or polyclonal." ; oboInOwl:hasExactSynonym "anti tag western" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0705" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "anti tag western blot" ; rdfs:subClassOf obo:MI_0113, obo:MI_0866 . obo:MI_0706 obo:IAO_0000115 "Transformation is the genetic alteration of a cell resulting from the introduction, uptake and expression of foreign genetic material incorporated into the cell's genome (DNA or RNA)." ; oboInOwl:hasExactSynonym "nucl transformation" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0706" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "nucleic acid transformation" ; rdfs:subClassOf obo:MI_0704 . obo:MI_0707 obo:IAO_0000115 "Immunostaining assay performed when specific antibodies for the protein of interest are not available. Therefore the protein is expressed as a hybrid protein fused to a tag peptide/protein for which efficient antibodies are available. The anti tag antibody may be either monoclonal or polyclonal." ; oboInOwl:hasExactSynonym "anti tag immunost" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0707" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "anti tag immunostaining" ; rdfs:subClassOf obo:MI_0422 . obo:MI_0708 obo:IAO_0000115 "A monospecific antibody for the protein of interest is available, this is used to detect a specific protein within a cell or tissue sample." ; oboInOwl:hasExactSynonym "monoclonal immunost" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0708" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "monoclonal antibody immunostaining" ; rdfs:subClassOf obo:MI_0422 . obo:MI_0709 obo:IAO_0000115 "Immunostaining assay carried out using a mixture of different antibodies that represent the immune response, normally in an experimental animal, to the protein of interest. These antibodies are used to detect the protein within a cell or tissue sample." ; oboInOwl:hasExactSynonym "polyclonal immunost" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0709" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "polyclonal antibody immunostaining" ; rdfs:subClassOf obo:MI_0422 . obo:MI_0710 obo:IAO_0000115 "Stable introduction and expression of nucleic acid carried out by treatment with divalent cation." ; oboInOwl:hasExactSynonym "n transformat cation" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0710" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "nucleic acid transformation by treatment with divalent cation" ; rdfs:subClassOf obo:MI_0706 . obo:MI_0711 obo:IAO_0000115 "Electroporation, or electropermeabilization, is a significant increase in the electrical conductivity and permeability of the cell plasma membrane caused by externally applied electrical field. It is usually used in molecular biology as a way of introducing some substance inside the cell, such as loading it with a molecular probe, a drug that can change cell's function, or a piece of coding DNA." ; oboInOwl:hasExactSynonym "nucl electroporation" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0711" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "nucleic acid electroporation" ; rdfs:subClassOf obo:MI_0308, obo:MI_0704 . obo:MI_0712 obo:IAO_0000115 "Microinjection refers to the process of using a micro needle to insert substances at a microscopic level into a single living cell. It is a simple mechanical process in which an extremely fine micro needle penetrates the cell membrane and sometimes the nuclear envelope and releases nucleic acids." ; oboInOwl:hasExactSynonym "nucl microinjection" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0712" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "nucleic acid microinjection" ; rdfs:subClassOf obo:MI_0311, obo:MI_0704 . obo:MI_0713 obo:IAO_0000115 "Nucleic acid entrance into cells that does not involved specific treatments but rely on natural cellular processes." ; oboInOwl:hasExactSynonym "nucl passive uptake" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0713" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "nucleic acid passive uptake" ; rdfs:subClassOf obo:MI_0704, obo:MI_0716 . obo:MI_0714 obo:IAO_0000115 "Transduction is the process by which bacterial DNA is moved from one bacterium to another by a virus." ; oboInOwl:hasExactSynonym "nucl transduction" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0714" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "nucleic acid transduction" ; rdfs:subClassOf obo:MI_0704 . obo:MI_0715 obo:IAO_0000115 "Bacterial conjugation is the transfer of genetic material between bacteria through cell-to-cell contact. Bacterial conjugation is often incorrectly regarded as the bacterial equivalent of sexual reproduction or mating. It is not actually sexual, as it does not involve the fusing of gametes and the creation of a zygote. It is merely the transfer of a conjugative plasmid from a donor cell to a recipient" ; oboInOwl:hasExactSynonym "nucl conjugation" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0715" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "nucleic acid conjugation" ; rdfs:subClassOf obo:MI_0704 . obo:MI_0716 obo:IAO_0000115 "Entrance of molecules into cells that does not involved specific treatments but relies on natural cellular processes." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0716" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "passive uptake" ; rdfs:subClassOf obo:MI_0307 . obo:MI_0717 obo:IAO_0000115 "Lipofection (or liposome transfection) is a technique used to inject genetic material into a cell by means of liposomes which are vesicles that can easily merge with the cell membrane since they are both made of a phospholipid bilayer." ; oboInOwl:hasExactSynonym "nucl lipotransfect" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0717" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "nucleic acid transfection with liposome" ; rdfs:subClassOf obo:MI_0312 . obo:MI_0718 obo:IAO_0000115 "Transient introduction and expression of nucleic acid carried out by treatment with chemicals." ; oboInOwl:hasExactSynonym "n transfection treat" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0718" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "nucleic acid transfection by treatment" ; rdfs:subClassOf obo:MI_0312 . obo:MI_0719 obo:IAO_0000115 "Transient introduction and expression of nucleic acid carried out by treatment with calcium phosphate." ; oboInOwl:hasExactSynonym "ca po nuc transfect" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0719" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "calcium phosphate nucleic acid transfection" ; rdfs:subClassOf obo:MI_0718 . obo:MI_0720 obo:IAO_0000115 "Nucleic acid introduced into a cell via an external organism, usually a virus or bacteria.." ; oboInOwl:hasExactSynonym "nucl infection" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0720" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "nucleic acid delivery by infection" ; rdfs:subClassOf obo:MI_0310, obo:MI_0704 . obo:MI_0721 obo:IAO_0000115 "Method by which proteins are delivered into a cell." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0721" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "protein delivery" ; rdfs:subClassOf obo:MI_0307 . obo:MI_0722 obo:IAO_0000115 "Method for temporarily permeabilising cell membranes in order to facilitate the entry of a protein." ; oboInOwl:hasExactSynonym "prot electroporation" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0722" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "protein electroporation" ; rdfs:subClassOf obo:MI_0308, obo:MI_0721 . obo:MI_0723 obo:IAO_0000115 "Microinjection refers to the process of using a micro needle to insert substances at a microscopic level into a single living cell. It is a simple mechanical process in which an extremely fine micro needle penetrates the cell membrane and sometimes the nuclear envelope and releases proteins." ; oboInOwl:hasExactSynonym "prot microinjection" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0723" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "protein microinjection" ; rdfs:subClassOf obo:MI_0311, obo:MI_0721 . obo:MI_0724 obo:IAO_0000115 "Proteins are delivered into cells by treatment with cationic lipids." ; oboInOwl:hasExactSynonym "prot cationic lipid" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0724" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "protein delivery by cationic lipid treatment" ; rdfs:subClassOf obo:MI_0721 . obo:MI_0725 obo:IAO_0000115 "Protein introduced into a cell via an external organism, usually a virus or bacteria." ; oboInOwl:hasExactSynonym "prot infection" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0725" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "protein delivery by infection" ; rdfs:subClassOf obo:MI_0310, obo:MI_0721 . obo:MI_0726 obo:IAO_0000115 "Yeast strains are generated in which expression of DB-X/AD-Y or DBPX hybrid proteins is toxic under particular conditions (negative selection). Under these conditions, dissociation of an interaction should provide a selective advantage thereby facilitating detection: a few growing yeast colonies in which DB-X/AD-Y (or DBPX/binding site) fail to interact should be identified among many nongrowing colonies containing interacting DB-X/AD-Y or DBPX/binding site." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0726" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "reverse two hybrid" ; rdfs:subClassOf obo:MI_0003, obo:MI_0232 . obo:MI_0727 obo:IAO_0000115 "Yeast two-hybrid system using Escherichia coli LexA amino acids 1-202 as the DNA-binding domain (BD), E. coli B42 acidic sequence as the activation domain (AD), and two reporters, lacZ and LEU2, each containing upstream LexA binding elements." ; oboInOwl:hasExactSynonym "LexA B52 transcription complementation", "lexa b52 complement" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0727" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "lexa b52 complementation" ; rdfs:subClassOf obo:MI_0018 . obo:MI_0728 obo:IAO_0000115 "A chimeric protein consisting of the GAL4 DNA-binding domain (aa 1-147 of GAL4) and a transcriptional activation domain from the herpes simplex virus protein VP16 (either aa 411-490 or aa 411-455) can specifically activate transcription of a reporter gene located downstream ofGAL4 DNA binding sites and the E1B minimal promoter. Similarly, two chimeric proteins, one encoding a chimeric GAL4 protein and the other encoding a chimeric VP16 protein, can activate the reporter gene, if the domains fused to the GAL4 and VP16 sequences can complex with appropriate conformation. However, if the domains fused to the GAL4 and VP16 sequences do not interact specifically to form a + complex that reconstitutes GAL4 function, the reporter gene cannot be activated." ; oboInOwl:hasExactSynonym "KISS", "gal4 vp16 complement", "karyoplasmic interaction ion strategy", "mammalian two hybrid" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0728" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "gal4 vp16 complementation" ; rdfs:subClassOf obo:MI_0018 . obo:MI_0729 obo:IAO_0000115 "This strategy uses a luciferase enzyme fused to proteins of interest, which are then coexpressed with individual epitope-tagged partners in mammalian cells. Their interactions are determined by performing an enzymatic assay on anti-tag immunoprecipitates." ; oboInOwl:hasExactSynonym "lumier" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0729" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "luminescence based mammalian interactome mapping" ; rdfs:subClassOf obo:MI_0004 . obo:MI_0730 obo:IAO_0000115 """PubChem provides information on the biological activities of small molecules. http://pubchem.ncbi.nlm.nih.gov/""" ; oboInOwl:hasExactSynonym "PubChem" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0730" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "pubchem" ; rdfs:subClassOf obo:MI_2054 . obo:MI_0731 obo:IAO_0000115 "The aim of 3D Repertoire is to determine the structures of all amenable complexes in a cell at medium or high resolution, which will later serve to integrate in toponomic and dynamic analyses of protein complexes in a cell. Complex models, EM pictures, expression and purification protocols obtained in the project will be collected in a database connected to the PDB repository." ; oboInOwl:hasExactSynonym "3D Repertoire" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0731" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "3d repertoire" ; rdfs:subClassOf obo:MI_0489 . obo:MI_0732 obo:IAO_0000115 "The red fluorescent protein derived from, for example, marine anemone Discosoma striata and reef corals belonging to the class Anthozoacan can be fused to individual proteins which then acquire fluorescence excitation and emission spectra virtually identical to those of the native." ; oboInOwl:hasExactSynonym "RFP", "red fluorescent protein", "rfp tag" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0732" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "red fluorescent protein tag" ; rdfs:subClassOf obo:MI_0687 . obo:MI_0733 obo:IAO_0000115 "The cyan fluorescent protein derived from Anthozoa reef coral can be fused to individual proteins which then acquire fluorescence excitation and emission spectra virtually identical to those of the native." ; oboInOwl:hasExactSynonym "CFP", "cfp tag", "cyan fluorescent protein" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0733" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "cyan fluorescent protein tag" ; rdfs:subClassOf obo:MI_0687 . obo:MI_0734 obo:IAO_0000115 "Variation of the green fluorescent protein derived from the bioluminescent jellyfish Aequorea victoria, can be fused to individual proteins which then acquire fluorescence excitation and emission spectra virtually identical to those of the native." ; oboInOwl:hasExactSynonym "EGFP", "egfp tag", "enhanced green fluorescent protein" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0734" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "enhanced green fluorescent protein tag" ; rdfs:subClassOf obo:MI_0367 . obo:MI_0735 obo:IAO_0000115 "Tag derived from the transactivating (Tat) protein of human immunodeficiency virus 1 (HIV-1) that can enter cells efficiently when added exogenously in tissue culture. The Tat tag can carry other molecules into cells, by fusion of Tat peptides (residues 1-72 or 37-72,) to any molecule under study. Tat-mediated uptake may allow the delivery of macromolecules previously thought to be impermeable to living cells." ; oboInOwl:hasExactSynonym "Tat tag", "tat tag" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0735" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "transactivating tag" ; rdfs:subClassOf obo:MI_0740 . obo:MI_0736 obo:IAO_0000115 "Proteins entrance into cells that does not involved specific treatments but rely on natural cellular processes." ; oboInOwl:hasExactSynonym "prot passive uptake" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0736" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "protein passive uptake" ; rdfs:subClassOf obo:MI_0716, obo:MI_0721 . obo:MI_0737 obo:IAO_0000115 "database storing sequences detected by peptide identification methods." ; oboInOwl:hasExactSynonym "pep seq db" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0737" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "peptide sequence database" ; rdfs:subClassOf obo:MI_0683 . obo:MI_0738 obo:IAO_0000115 """PRIDE is a public repository of protein and peptide identifications for the proteomics community. http://www.ebi.ac.uk/pride/""" ; oboInOwl:hasDbXref "search-url:" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0738" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "pride" ; rdfs:subClassOf obo:MI_0737 . obo:MI_0739 obo:IAO_0000115 "Membrane shuttling peptide derived from the Drosophila homeobox protein Antennapedia: RQIKIWFQNRRMKWKK" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0739" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "penetrating tag" ; rdfs:subClassOf obo:MI_0740 . obo:MI_0740 obo:IAO_0000115 "The peptides named CPPs vary greatly in size, amino acid sequence, and charge, but share the common feature that they have the ability to rapidly translocate the plasma membrane and enable delivery to the cytoplasm or nucleus." ; oboInOwl:hasExactSynonym "CPPs", "MTS", "PTDs", "Trojan peptides", "cell penetrating pep", "cell-penetrating peptides", "membrane translocating sequences", "protein transduction domains" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0740" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "cell penetrating peptide tag" ; rdfs:subClassOf obo:MI_0507 . obo:MI_0741 obo:IAO_0000115 """PeptideAtlas addresses these needs by identifying peptides by tandem mass spectrometry (MS/MS), statistically validating those identifications and then mapping identified sequences to the genomes of eukaryotic organisms. http://www.peptideatlas.org/""" ; oboInOwl:hasExactSynonym "PeptideAtlas" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0741" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "peptide atlas" ; rdfs:subClassOf obo:MI_0737 . obo:MI_0742 obo:IAO_0000115 """Global Proteome Machine aim to improve the quality of analysis, make the results portable and to provide a common platform for testing and validating proteomics results. http://www.thegpm.org""" ; oboInOwl:hasExactSynonym "Global Proteome Machine" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0742" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "gpm" ; rdfs:subClassOf obo:MI_0737 . obo:MI_0787 obo:IAO_0000115 "Descriptor of an experimental form involved in a genetic interaction" ; oboInOwl:hasExactSynonym "genetic exp form" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0787" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "genetic experimental form" ; rdfs:subClassOf obo:MI_0346 . obo:MI_0788 obo:IAO_0000115 "The gene has been completely removed e.g. by genetic engineering " ; oboInOwl:hasExactSynonym "knock-out" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0788" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "knock out" ; rdfs:subClassOf obo:MI_0804 . obo:MI_0789 obo:IAO_0000115 "The gene expression has been significantly reduced compared to wild-type by introduction of an external substance, e.g. by RNA interference." ; oboInOwl:hasExactSynonym "knock-down" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0789" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "knock down" ; rdfs:subClassOf obo:MI_0804 . obo:MI_0790 obo:IAO_0000115 "The gene function has been partially improved compared to wild-type by altering its sequence." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0790" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "hypermorph" ; rdfs:subClassOf obo:MI_0787 . obo:MI_0791 obo:IAO_0000115 "The gene function has been partially reduced compared to wild-type by altering its sequence e.g. a temperature sensitive mutant." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0791" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "hypomorph" ; rdfs:subClassOf obo:MI_0787 . obo:MI_0792 obo:IAO_0000115 "The gene function has been antagonized by a mutation in another copy of the gene." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0792" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "antimorph" ; rdfs:subClassOf obo:MI_0787 . obo:MI_0793 obo:IAO_0000115 "The gene function has been abolished by mutation, though the type of mutation is not known." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0793" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "amorph" ; rdfs:subClassOf obo:MI_0787 . obo:MI_0794 obo:IAO_0000115 """An effect in which two genetic perturbations, when combined, result in a mutant phenotype that is not observed (or minimally observed) as a result of any of the individual perturbations. wt = a = b = E (not=) ab""" ; oboInOwl:hasExactSynonym "aphenotypic diverging genetic interaction", "synthetic genetic interaction (sensu inequality)", "synthetic genetic interaction defined by inequality" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0794" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "synthetic genetic interaction" ; rdfs:subClassOf obo:MI_0933, obo:MI_2381 . obo:MI_0795 obo:IAO_0000115 """An effect in which individual perturbations of different genes and their combination result in the same mutant phenotype, to the same degree of severity/penetrance. With respect to any single quantifiable phenotype, this may be expressed as an inequality as: a = b = ab != wt where 'a' and 'b' are the observed phenotype values of the individual perturbations, 'ab' is the observed phenotype value of the double perturbation, and 'wt' is the wild type phenotype value.""" ; mi:isDefinedBy "A, B, and the AB combination all have the same effect on the WT background (2 inequalities).", "Another subtype of alleviating interaction, 'coequal' interaction, is defined by single- and double-mutant strains that exhibit fitness values that are indistinguishable from one another (19).", "Lastly, we observed ten gene pairs for which the MMS sensitivity of the single- and double-deletion strains was statistically indistinguishable (Sxy = Sx = Sy). These interactions, which we call ‘coequal’, are related to‘complementary gene action’, ‘complementary epistasis’ or ‘asynthetic’ relationship types that have been previously described18,30,31." ; oboInOwl:hasExactSynonym "asynthetic", "asynthetic genetic interaction (sensu inequality)", "coequal genetic interaction", "isophenotypic masking genetic interaction" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0795" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "asynthetic genetic interaction" ; rdfs:subClassOf obo:MI_0935, obo:MI_2386 . obo:MI_0796 obo:IAO_0000115 """An effect in which two genetic perturbations, when combined, result in a phenotype that is less severe/penetrant than the most severe phenotype of the original perturbations, in effect making the organism more \"wild type\" in character with regards to the phenotype in question. With respect to any single quantifiable phenotype, this may be expressed as an inequality as: a* < ab <= wt [E = a*] OR wt <= ab < a* [E = a*] where 'a*' is the most severe observed phenotype value of the individual perturbations, 'ab' is the observed phenotype value of the double perturbation, 'E' is the expected phenotype value of the double perturbation, and 'wt' is the wild type phenotype value.""" ; oboInOwl:hasExactSynonym "suppression", "suppressive genetic interaction (sensu inequality)" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:hasRelatedSynonym "Alleviating interaction" ; oboInOwl:id "MI:0796" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "genetic suppression (sensu unexpected)" ; rdfs:subClassOf obo:MI_0935, obo:MI_2379 . obo:MI_0797 obo:IAO_0000115 """An effect in which individual perturbations of two different genes result in different mutant phenotypes, and the resulting phenotype of their combination (the double mutant) is equal to that of only one of the perturbations. With respect to any single quantifiable phenotype, this may be expressed as an inequality as: (a != wt AND b != wt AND a != b) AND (ab = a OR ab = b) where 'a' and 'b' are the observed phenotype values of the individual perturbations, 'ab' is the observed phenotype value of the double perturbation, 'wt' is the wild type phenotype value and 'a != b' indicates qualitatively or quantitatively different phenotypes.""" ; oboInOwl:hasBroadSynonym "masking genetic interaction" ; oboInOwl:hasExactSynonym "Bateson genetic epistasis", "epistatic", "epistatic genetic interaction (sensu inequality)" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0797" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "genetic epistasis (sensu Bateson)" ; rdfs:subClassOf obo:MI_0208 . obo:MI_0798 obo:IAO_0000115 "The phenotype resulting from genetic perturbation of A has an effect only in the b background, or the b mutant has an effect only in the a background. a has an effect only in the b background, or the b mutant has an effect only in the a background. E. g., WT = a > ab > b or WT > a > b > ab." ; oboInOwl:hasExactSynonym "conditional", "conditional genetic interaction (sensu inequality)" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0798" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "conditional genetic interaction defined by inequality" ; owl:deprecated true . obo:MI_0799 obo:IAO_0000115 "Single-mutant phenotype effects combine to give a double-mutant effect different from the wild type and different from single mutant effect. For instance, WT < a = b < ab, b < WT = ab < a, WT < a < b < ab, b < WT < ab < a, and all additional inequalities obtained by interchanging a and b, or reversing the effect of both a and b." ; oboInOwl:hasExactSynonym "additive", "additive genetic interaction (sensu inequality)" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0799" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "additive genetic interaction defined by inequality" ; owl:deprecated true . obo:MI_0800 obo:IAO_0000115 "The phenotype resulting from genetic perturbation of B shows opposing effects in the WT and a backgrounds (for example, b > WT and ab < a); or, a shows opposing effects in the WT and b backgrounds, but not both. E.g., WT > a > ab > b." ; oboInOwl:hasExactSynonym "single nonmonotonic", "single nonmonotonic genetic interaction (sensu inequality)" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0800" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "single nonmonotonic genetic interaction defined by inequality" ; owl:deprecated true . obo:MI_0801 obo:IAO_0000115 "The phenotype resulting from genetic perturbation of both A and B show opposing effects in the WT background and the background with the other mutant gene. E.g., WT >= ab > a >= b" ; oboInOwl:hasExactSynonym "double nonmonotonic", "double nonmonotonic genetic interaction (sensu inequality)" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0801" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "double nonmonotonic genetic interaction defined by inequality" ; owl:deprecated true . obo:MI_0802 obo:IAO_0000115 """The A genetic perturbation enhances the phenotype of the B perturbation, or vice versa (e.g. WT = A < B < AB or WT = B < A < AB). This could be conditional or additive by the above scheme. OBSOLETE: remap to MI:0933 'negative genetic interaction'""" ; oboInOwl:hasExactSynonym "enhancement" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0802" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "enhancement interaction" ; owl:deprecated true . obo:MI_0803 obo:IAO_0000115 "Synthesis rate of a molecule under investigation differs from its naturally occurring expression level in a cell." ; oboInOwl:hasExactSynonym "expression modif" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0803" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "expression level alteration" ; rdfs:subClassOf obo:MI_0787 . obo:MI_0804 obo:IAO_0000115 "The gene is mutated in some unknown manner" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0804" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "mutated gene" ; rdfs:subClassOf obo:MI_0787 . obo:MI_0805 obo:IAO_0000115 """The Worldwide Protein Data Bank (wwPDB) consists of organizations that act as deposition, data processing and distribution centers for PDB data. The founding members are RCSB PDB (USA), MSD-EBI (Europe) and PDBj (Japan). The BMRB (USA) group joined the wwPDB in 2006. The mission of the wwPDB is to maintain a single Protein Data Bank Archive of macromolecular structural data that is freely and publicly available to the global community. http://www.wwpdb.org/""" ; oboInOwl:hasDbXref "id-validation-regexp:", "search-url:" ; oboInOwl:hasExactSynonym "wwPDB" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0805" ; oboInOwl:inSubset mi:Drugable, mi:PSI-MI_slim ; a owl:Class ; rdfs:label "wwpdb" ; rdfs:subClassOf obo:MI_0447, obo:MI_0461, obo:MI_0489 . obo:MI_0806 obo:IAO_0000115 """PDBj(Protein Data Bank Japan) maintains the database for the protein structures with financial assistance from the Institute for Bioinformatics Research and Development of Japan Science and Technology Corporation(BIRD-JST), collaborating with the Research Collaboration for Structural Bioinformatics(RCSB) and the MSD in the European Bioinformatics Institute(MSD-EBI) in EU. All three organizations serve as deposition, data processing and distribution sites. http://www.pdbj.org/""" ; oboInOwl:hasDbXref "id-validation-regexp:", "search-url:" ; oboInOwl:hasExactSynonym "PDBj" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0806" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "pdbj" ; rdfs:subClassOf obo:MI_0805 . obo:MI_0807 obo:IAO_0000115 "The interaction of two or more molecules is determined by their very close proximity or the overlap of their respective bands in a gel." ; oboInOwl:hasExactSynonym "comigration in gel" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0807" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "comigration in gel electrophoresis" ; rdfs:subClassOf obo:MI_0982 . obo:MI_0808 obo:IAO_0000115 "A method allowing the detection of strong interactions between two or more molecules as running, all of them, within a single band in a denaturing gel." ; oboInOwl:hasExactSynonym "comigration in sds" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0808" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "comigration in sds page" ; rdfs:subClassOf obo:MI_0807 . obo:MI_0809 obo:IAO_0000115 "The bimolecular fluorescence complementation (BiFC) is an assay for determination of protein interactions and/or their location in living cells. This approach is based on complementation between two non- fluorescent fragments of a protein fluorophore such as green fluorescent protein (GFP) or its derivatives. Interactions between proteins fused to each fragment bring the fragments together resulting in the reconstitution of a fully functional flourophore that can be identified through fluorescence spectroscopy or microscopy." ; oboInOwl:hasAlternativeId "MI:0229" ; oboInOwl:hasExactSynonym "bifc", "gfp complementation", "green fluorescence protein complementation assay" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0809" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "bimolecular fluorescence complementation" ; rdfs:subClassOf obo:MI_0051, obo:MI_0090 . obo:MI_0810 obo:IAO_0000115 "In this approach, once a molecule is demonstrated to participate in an interaction, several substitution mutants are produced and tested in the binding assay to identify the residues which identity is crucial for the interaction." ; oboInOwl:hasExactSynonym "substitut analysis" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0810" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "substitution analysis" ; rdfs:subClassOf obo:MI_0074 . obo:MI_0811 obo:IAO_0000115 "In this approach, once a molecule is demonstrated to participate in an interaction, several insertion derivatives are produced and tested in the binding assay to detect the regions that are important for the interaction." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0811" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "insertion analysis" ; rdfs:subClassOf obo:MI_0074 . obo:MI_0812 obo:IAO_0000115 "The protein is expressed and purified as a fusion to the calmoduling-binding protein. The fusion protein can be purified by affinity chromatography using a calmodulin resin." ; oboInOwl:hasExactSynonym "cam tag" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0812" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "calmodulin binding protein tag" ; rdfs:subClassOf obo:MI_0240 . obo:MI_0813 obo:IAO_0000115 "Upon binding of two proximity probes (usually antibodies conjugated to DNA) to the same target protein complex, the oligonucleotides on the proximity probes are brought close together. These antibody-conjugated oligonucleotides hybridize to two connector oligonucleotides that are ligated to form a circular DNA molecule. This newly formed DNA-molecule can be amplified by rolling circle amplification. The resulting single-stranded DNA-molecule collapses into a bundle, which is detectable through hybridization of fluorescently labeled complementary oligonucleotides." ; oboInOwl:hasExactSynonym "PLA", "p elisa", "pELISA" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:hasRelatedSynonym "in situ proximity ligation assay", "pLISA", "proximity ligation" ; oboInOwl:id "MI:0813" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "proximity ligation assay" ; rdfs:subClassOf obo:MI_0400, obo:MI_0421 . obo:MI_0814 obo:IAO_0000115 "In protease accessibility laddering (PAL) tagged proteins are purified on magnetic beads in their natively folded state. While attached to the beads, proteins are probed with proteases. Proteolytic fragments are eluted and detected by immunoblotting with antibodies against the tag (e.g., Protein A, GFP, and 6xHis)." ; oboInOwl:hasExactSynonym "pal", "protease access" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0814" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "protease accessibility laddering" ; rdfs:subClassOf obo:MI_0605 . obo:MI_0815 obo:IAO_0000115 "Molecule whose sequence identity is derived from their molecular weight" ; oboInOwl:hasExactSynonym "weight identificat" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0815" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "confirmation by molecular weight" ; rdfs:subClassOf obo:MI_0396 . obo:MI_0816 obo:IAO_0000115 "Molecule whose sequence identity is derived from their molecular weight after a comigration in a gel with molecular weight marker." ; oboInOwl:hasExactSynonym "weight by staining" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0816" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "molecular weight estimation by staining" ; rdfs:subClassOf obo:MI_0815 . obo:MI_0817 obo:IAO_0000115 "Molecule whose sequence identity is derived from their molecular weight after a comigration in a gel with molecular weight marker and staining of the molecules with silver." ; oboInOwl:hasExactSynonym "weight silver stain" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0817" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "molecular weight estimation by silver staining" ; rdfs:subClassOf obo:MI_0816 . obo:MI_0818 obo:IAO_0000115 "Molecule whose sequence identity is derived from their molecular weight after a comigration in a gel with molecular weight marker and staining of the molecules with comassie dye." ; oboInOwl:hasExactSynonym "weight by comassie" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0818" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "molecular weight estimation by coomasie staining" ; rdfs:subClassOf obo:MI_0816 . obo:MI_0819 obo:IAO_0000115 "Molecule whose sequence identity is derived from their molecular weight after a comigration in a gel with molecular weight marker and staining of the molecules with bromide dyes." ; oboInOwl:hasExactSynonym "weight by bromide" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0819" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "molecular weight estimation by bromide staining" ; rdfs:subClassOf obo:MI_0816 . obo:MI_0820 obo:IAO_0000115 "Molecule whose sequence identity is derived from their molecular weight after a comigration in a gel with molecular weight marker and staining of the molecules with sybr dyes." ; oboInOwl:hasExactSynonym "safe DNA gel stain", "weight by sybr" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0820" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "molecular weight estimation by sybr staining" ; rdfs:subClassOf obo:MI_0816 . obo:MI_0821 obo:IAO_0000115 "Molecule whose sequence identity is derived from their molecular weight after a comigration in a gel with molecular weight marker and staining by autoradiography." ; oboInOwl:hasExactSynonym "weight autoradiogra" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0821" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "molecular weight estimation by autoradiography" ; rdfs:subClassOf obo:MI_0815 . obo:MI_0822 obo:IAO_0000115 "Molecule whose sequence identity is derived from their molecular weight after a comigration in a gel with molecular weight marker and staining of the molecules with Hoechst dyes." ; oboInOwl:hasExactSynonym "weight by hoechst" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0822" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "molecular weight estimation by hoechst staining" ; rdfs:subClassOf obo:MI_0816 . obo:MI_0823 obo:IAO_0000115 "Feature detection not verified in the context of an experiment but assumed from external or previous experimental evidence(s)." ; oboInOwl:hasExactSynonym "predetermined featur" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0823" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "predetermined feature" ; rdfs:subClassOf obo:MI_0093, obo:MI_0427, obo:MI_0659 . obo:MI_0824 obo:IAO_0000115 "Analysis of a diffraction pattern generated by an isotropic sample composed of many randomly oriented crystals." ; oboInOwl:hasExactSynonym "X-ray", "x-ray powder diffrac" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0824" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "x-ray powder diffraction" ; rdfs:subClassOf obo:MI_0114 . obo:MI_0825 obo:IAO_0000115 "Analysis of the diffraction pattern of a partially ordered sample composed of fibers oriented parallel to each other using X-ray." ; oboInOwl:hasExactSynonym "X-ray", "x-ray fiber diffrac" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0825" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "x-ray fiber diffraction" ; rdfs:subClassOf obo:MI_0114 . obo:MI_0826 obo:IAO_0000115 "Method where the internal structure of a sample is derived from the intensity distribution of the scattered monochromatic X-ray beam at very low scattering angles." ; oboInOwl:hasExactSynonym "saxs" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0826" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "x ray scattering" ; rdfs:subClassOf obo:MI_0067 . obo:MI_0827 obo:IAO_0000115 "X-ray Tomography is a branch of X-ray microscopy. A series of projection images are used to calculate a three dimensional reconstruction of an object. The technique has found many applications in materials science and later in biology and biomedical research. In terms of the latter, the National Center for X-ray Tomography (NCXT) is one of the principle developers of this technology, in particular for imaging whole, hydrated cells." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0827" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "x-ray tomography" ; rdfs:subClassOf obo:MI_0428 . obo:MI_0828 obo:IAO_0000115 "Subpart of a polyprotein that is naturally cleaved in vivo." ; oboInOwl:hasExactSynonym "polyprotein frag" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:hasRelatedSynonym "chain" ; oboInOwl:id "MI:0828" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "polyprotein fragment" ; rdfs:subClassOf obo:MI_0252 . obo:MI_0829 obo:IAO_0000115 "This qualifier is used for hybrid or composite molecules with more than one cross-reference to parent molecules." ; oboInOwl:hasExactSynonym "multiple parent" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0829" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "multiple parent reference" ; rdfs:subClassOf obo:MI_0353 . obo:MI_0830 obo:IAO_0000115 """List of tissue used as topic in UniProt RC line. http://www.expasy.org/cgi-bin/lists?tisslist.txt""" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0830" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "tissue list" ; rdfs:subClassOf obo:MI_0473 . obo:MI_0831 obo:IAO_0000115 """Ontology of cell types. http://obo.sourceforge.net/cgi-bin/detail.cgi?cell""" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0831" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "cell ontology" ; rdfs:subClassOf obo:MI_0473 . obo:MI_0832 obo:IAO_0000115 "A protein modification that is effectively either one half of a cystine cross-link, or a cysteine residue with one hydrogen atom or proton removed" ; oboInOwl:hasExactSynonym "Half of a disulfide bridge" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0832" ; a owl:Class ; rdfs:label "half cystine" ; owl:deprecated true . obo:MI_0833 obo:IAO_0000115 "Experimental method by which radiolabel is detected by exposure to a photographic emulsion forming a pattern on the film." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0833" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "autoradiography" ; rdfs:subClassOf obo:MI_0659, obo:MI_0866 . obo:MI_0834 obo:IAO_0000115 "Association rate constant or rate of complex formation. Unit MOLE per SECOND (M-1 s-1)" ; oboInOwl:hasExactSynonym "kon" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0834" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "ka" ; rdfs:subClassOf obo:MI_0640 . obo:MI_0835 obo:IAO_0000115 "Dissociation rate constant measuring the stability of a complex. Unit SECOND (s-1)" ; oboInOwl:hasExactSynonym "koff" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:hasRelatedSynonym "Kd" ; oboInOwl:id "MI:0835" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "koff" ; rdfs:subClassOf obo:MI_0640 . obo:MI_0836 obo:IAO_0000115 "Temperature at which interaction was determined. Unit KELVIN (K)" ; oboInOwl:hasExactSynonym "T interaction", "Tint", "temp interaction" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0836" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "temperature of interaction" ; rdfs:subClassOf obo:MI_0640 . obo:MI_0837 obo:IAO_0000115 "pH at which interaction was determined." ; oboInOwl:hasExactSynonym "pHint" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0837" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "pH of interaction" ; rdfs:subClassOf obo:MI_0640 . obo:MI_0838 obo:IAO_0000115 "The kelvin (K) is the SI unit of thermodynamic temperature. It is defined by taking the fixed numerical value of the Boltzmann constant k to be 1.380649×10-23 when expressed in the unit J·K-1, which is equal to kg·m2·s-2·K-1, where the kilogram, metre and second are defined in terms of h, c and caesium frequency. It is equivalent to -273.15°C / -459.67°F." ; oboInOwl:hasExactSynonym "K" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0838" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "kelvin" ; rdfs:subClassOf obo:MI_0647 . obo:MI_0839 obo:IAO_0000115 "Per mole per second, unit for association rate constant." ; oboInOwl:hasExactSynonym "M-1s-1" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0839" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "per mole per second" ; rdfs:subClassOf obo:MI_0647 . obo:MI_0840 obo:IAO_0000115 "Molecule stimulating an interaction by interacting with one or more of the participants." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0840" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "stimulator" ; rdfs:subClassOf obo:MI_2274 . obo:MI_0841 obo:IAO_0000115 "Measures the rate of a phosphate transfer between two molecules." ; oboInOwl:hasExactSynonym "phosphotransferase" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:hasRelatedSynonym "phosphotransfer assay" ; oboInOwl:id "MI:0841" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "phosphotransferase assay" ; rdfs:subClassOf obo:MI_0415 . obo:MI_0842 obo:IAO_0000115 "Any molecule that is able to transfer a phosphate group to another chemical species." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0842" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "phosphate donor" ; rdfs:subClassOf obo:MI_0918 . obo:MI_0843 obo:IAO_0000115 "Molecule to which a phosphate group may be transferred from a phosphate donor." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0843" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "phosphate acceptor" ; rdfs:subClassOf obo:MI_0919 . obo:MI_0844 obo:IAO_0000115 "Reaction where a phosphate is transferred between two proteins of a phosphorelay system." ; oboInOwl:hasExactSynonym "phosphotransfer" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0844" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "phosphotransfer reaction" ; rdfs:subClassOf obo:MI_0414 . obo:MI_0845 obo:IAO_0000115 "Paramagnetic fragment, most often a cyclic nitroxide derivative, covalently attached to a molecule of interest." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0845" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "spin label" ; rdfs:subClassOf obo:MI_0505 . obo:MI_0846 obo:IAO_0000115 """Paramagnetic molecule (1-oxyl-2,2,5,5-tetramethylpyrroline- 3-methyl)-methanethiosulfonate. that can be covalently attached to any cysteine aminoacid producing a nitroxide side chain designated R1.""" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0846" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "r1 spin label" ; rdfs:subClassOf obo:MI_0845 . obo:MI_0847 obo:IAO_0000115 "Dansyl is the acronym of 5-dimethylaminonaphthalene-1-sulfonyl radical group reacting with any NH2 groups." ; oboInOwl:hasExactSynonym "5-dimethylaminonaphthalene-1-sulfonyl tag", "dansyl tag" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0847" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "dansyl label" ; rdfs:subClassOf obo:MI_0857 . obo:MI_0848 obo:IAO_0000115 "Molecule labelled with 125 radio isotope of iodine atoms." ; oboInOwl:hasExactSynonym "125I", "I125" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0848" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "125i radiolabel" ; rdfs:subClassOf obo:MI_0517 . obo:MI_0849 obo:IAO_0000115 """The NCBI taxonomy database indexes over 55 000 organisms that are represented in the sequence databases with at least one nucleotide or protein sequence. The Taxonomy Browser can be used to view the taxonomic position or retrieve sequence and structural data for a particular organism or group of organisms. Searches of the NCBI taxonomy may be made on the basis of whole or partial organism names, and direct links to organisms commonly used in biological research are also provided. The Taxonomy Browser can also be used to display the number of nucleic acid sequences, protein sequences, and protein structures available for organisms included in the branch. From the data display for a particular organism, one can retrieve and download the sequence data for that organism, or protein 3D structure data if available. http://www.ncbi.nlm.nih.gov/Taxonomy/""" ; oboInOwl:hasDbXref "id-validation-regexp:", "search-url:" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0849" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "ncbi taxonomy" ; rdfs:subClassOf obo:MI_0473 . obo:MI_0850 obo:IAO_0000115 """ENCODE (the Encyclopedia Of DNA Elements) seeks to identify all protein-coding genes. The current ENCODE data set is derived from 1% of the human genome and has been selected for analysis in the pilot phase of the project. http://www.genome.gov/10005107""" ; oboInOwl:hasExactSynonym "ENCODE", "Encyclopedia Of DNA Elements" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0850" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "encode" ; rdfs:subClassOf obo:MI_1094 . obo:MI_0851 obo:IAO_0000115 "GenBank Identifier or GI numbers for proteins." ; oboInOwl:hasDbXref "id-validation-regexp:", "search-url:" ; oboInOwl:hasExactSynonym "GenBank Protein GI", "genbank protein gi", "genbank_protein_gi", "genpept id" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0851" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "protein genbank identifier" ; rdfs:subClassOf obo:MI_0860 . obo:MI_0852 obo:IAO_0000115 "GenBank Identifier or GI numbers for nucleotide." ; oboInOwl:hasDbXref "id-validation-regexp:", "search-url:" ; oboInOwl:hasExactSynonym "GenBank Nucleotide", "genbank nucleotide", "genbank_nucl_gi" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0852" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "nucleotide genbank identifier" ; rdfs:subClassOf obo:MI_0860 . obo:MI_0853 obo:IAO_0000115 "An overhang is a stretch of unpaired nucleotides in the end of a DNA molecule. These unpaired nucleotides can be in either strand, creating either 3' or 5' overhangs. Longer overhangs are called cohessive ends or sticky ends. They are most often created by restriction endonucleases when they cut DNA. Very often they cut the two DNA strands four base pairs from each other, creating a four-base 3' overhang in the other molecule and a complementary 5' overhang in the other. These ends are called cohessive since they are easily joined back together by a ligase" ; oboInOwl:hasExactSynonym "cohessive ends", "sticky ends" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0853" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "dna overhang" ; rdfs:subClassOf obo:MI_0505 . obo:MI_0854 obo:IAO_0000115 "An overhang is a stretch of unpaired nucleotides in the end of a 3' strand of a DNA molecule." ; oboInOwl:hasExactSynonym "3 prime sticky end" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0854" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "3 prime overhang" ; rdfs:subClassOf obo:MI_0853 . obo:MI_0855 obo:IAO_0000115 "An overhang is a stretch of unpaired nucleotides in the end of a 5' strand of a DNA molecule." ; oboInOwl:hasExactSynonym "5 prime sticky end" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0855" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "5 prime overhang" ; rdfs:subClassOf obo:MI_0853 . obo:MI_0856 obo:IAO_0000115 "A fluorophore is a component of a molecule which causes a molecule to be fluorescent. It is a functional group in a molecule which will absorb energy of a specific wavelength and re-emit energy at a different (but equally specific) wavelength. The amount and wavelength of the emitted energy depend on both the fluorophore and the chemical environment of the fluorophore." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0856" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "fluorophore" ; rdfs:subClassOf obo:MI_0505 . obo:MI_0857 obo:IAO_0000115 "Dye label containing a fluorophore which absorb energy of a specific wavelength and re-emit energy at a different (but equally specific) wavelength." ; oboInOwl:hasExactSynonym "fluorescent dye" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0857" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "fluorescent dye label" ; rdfs:subClassOf obo:MI_0373, obo:MI_0856 . obo:MI_0858 obo:IAO_0000115 "Method involving consecutive coimmunoimmunoprecipitations on the same sample, a control where an interaction is detected, and other CoIPs where the sample is previously treated with a specific antibody that precipitates a candidate interactor and leads to the suppression of an interaction or a change in composition of a complex." ; oboInOwl:hasExactSynonym "immunodepleted coip", "immunodepletion" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0858" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "immunodepleted coimmunoprecipitation" ; rdfs:subClassOf obo:MI_0019 . obo:MI_0859 obo:IAO_0000115 "A single-molecule technique that measures the behavior of a molecular complex under stretching or torsional mechanical force." ; oboInOwl:hasExactSynonym "intermolecular force" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:hasRelatedSynonym "force measurement", "molecular force measurement", "single molecule force measurement", "surface adhesion force measurement" ; oboInOwl:id "MI:0859" ; a owl:Class ; rdfs:label "force spectroscopy" ; rdfs:subClassOf obo:MI_0013, obo:MI_2318 . obo:MI_0860 obo:IAO_0000115 " edit" ; oboInOwl:hasDbXref "id-validation-regexp:" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0860" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "genbank identifier" ; rdfs:subClassOf obo:MI_0683 . obo:MI_0861 obo:IAO_0000115 "The protein A is a bacterial cell wall isolated from Staphylococcus aureus that binds to mammalian IgGs mainly through Fc regions. The protein A can be use to retaint antibodies or as fusion tag of a protein under analysis." ; oboInOwl:hasExactSynonym "protein A" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0861" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "protein a tag" ; rdfs:subClassOf obo:MI_0240 . obo:MI_0862 obo:IAO_0000115 "The ZZ tag is a tag made out of two tandem repeats of the Protein A IgG binding domain. " ; oboInOwl:hasExactSynonym "ZZ tag" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0862" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "zz tag" ; rdfs:subClassOf obo:MI_0861 . obo:MI_0863 obo:IAO_0000115 "Thiol-reactive lanthanide complexes have been synthesized that are luminescent when bound to terbium and/or europium. The Tb3+-DTPA-cs124-EMCH complexes consist of a diethylenetriaminepentaacetate (DTPA) chelate covalently joined through one amide bond to a chromophore, carbostyril 124, and via a second amide bond to a maleimide, bromoacetamide, or pyridyldithio moiety. This label can be Site-specific attached to both proteins and DNA." ; oboInOwl:hasExactSynonym "Tb3+-DTPA-cs124-EMCH", "thiol lanthanide" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0863" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "thiol reactive lanthanide label" ; rdfs:subClassOf obo:MI_1256 . obo:MI_0864 obo:IAO_0000115 """A structured controlled vocabulary for the source of an enzyme. It comprises terms for tissues, cell lines, cell types and cell cultures from uni- and multicellular organisms. http://www.brenda-enzymes.info""" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0864" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "brenda" ; rdfs:subClassOf obo:MI_0473 . obo:MI_0865 obo:IAO_0000115 "Pair of fluorophores attached to the same molecule used in a fret experiment to observe the details of conformational changes." ; oboInOwl:hasExactSynonym "fret pair" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0865" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "fluorescence acceptor donor pair" ; rdfs:subClassOf obo:MI_2336 . obo:MI_0866 obo:IAO_0000115 "Molecule whose sequence identity is not checked after the interaction but its presence is detected through its tag." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0866" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "tag visualisation" ; rdfs:subClassOf obo:MI_0396 . obo:MI_0867 obo:IAO_0000115 "The molecule is produced fused to a tag containing a fluorophore, such as GFP tagged to a recombinant protein, or a fluorophore has been chemically attached to the molecule. Subsequence observation or measurement of fluorescence is used to identify the presence of the molecule in an interaction." ; oboInOwl:hasExactSynonym "tag fluorescence" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0867" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "tag visualisation by fluorescence" ; rdfs:subClassOf obo:MI_0866 . obo:MI_0868 obo:IAO_0000115 "Author published identifier." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0868" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "author identifier" ; rdfs:subClassOf obo:MI_0353 . obo:MI_0869 obo:IAO_0000115 "Identifier assigned when the record was created by a source database." ; oboInOwl:hasExactSynonym "original identifier" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0869" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "originally assigned identifier" ; rdfs:subClassOf obo:MI_0353 . obo:MI_0870 obo:IAO_0000115 "Measures the catalysis of the hydrolysis of an methyl group from a substrate molecule." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0870" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "demethylase assay" ; rdfs:subClassOf obo:MI_0415 . obo:MI_0871 obo:IAO_0000115 "The cleavage of a methyl group from a polypeptide. Methylation is generally an irreversible reaction except in mamalian." ; oboInOwl:hasExactSynonym "demethylation" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0871" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "demethylation reaction" ; rdfs:subClassOf obo:MI_0414 . obo:MI_0872 obo:IAO_0000115 """The atomic force microscope (AFM) is a very high-resolution type of scanning probe microscope, with demonstrated resolution of fractions of a nanometer, more than 1000 times better than the optical diffraction limit. The AFM was invented by Binnig, Quate and Gerber in 1986, and is one of the foremost tools for imaging, measuring and manipulating matter at the nanoscale.The term 'microscope' in the name is actually a misnomer because it implies looking, while in fact the information is gathered by feeling out the surface with a mechanical feeler. http://en.wikipedia.org/wiki/Atomic_force_microscope""" ; oboInOwl:hasExactSynonym "AFM", "atomic force microsc" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0872" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "atomic force microscopy" ; rdfs:subClassOf obo:MI_0428 . obo:MI_0873 obo:IAO_0000115 "Annotation of a published paper which has been externally requested." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0873" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "curation request" ; rdfs:subClassOf obo:MI_1093 . obo:MI_0875 obo:IAO_0000115 "Targeted curation dataset grouping experiments by topic or dataset origin." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0875" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "dataset" ; rdfs:subClassOf obo:MI_1093 . obo:MI_0878 obo:IAO_0000115 "Data directly submitted by the authors to a database prior to publication." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0878" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "author submitted" ; rdfs:subClassOf obo:MI_0665 . obo:MI_0879 obo:IAO_0000115 "Measures the catalysis of the hydrolysis of a nucleoside triphosphate into a nucleoside diphosphate plus phosphate." ; oboInOwl:hasExactSynonym "triphosphatase ass" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0879" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "nucleoside triphosphatase assay" ; rdfs:subClassOf obo:MI_0415, obo:MI_0434 . obo:MI_0880 obo:IAO_0000115 "Measures the catalysis of the hydrolysis of ATP+ H2O = ADP + phosphate." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0880" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "atpase assay" ; rdfs:subClassOf obo:MI_0879 . obo:MI_0881 obo:IAO_0000115 "Catalysis of the hydrolysis of a nucleoside triphosphate into a nucleoside diphosphate plus phosphate." ; oboInOwl:hasExactSynonym "triphosphatase react" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0881" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "nucleoside triphosphatase reaction" ; rdfs:subClassOf obo:MI_0414 . obo:MI_0882 obo:IAO_0000115 "Catalysis of the hydrolisis of ATP+ H2O = ADP + phosphate." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0882" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "atpase reaction" ; rdfs:subClassOf obo:MI_0881 . obo:MI_0883 obo:IAO_0000115 "Catalysis of the hydrolisis of GTP+ H2O = GDP + phosphate." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0883" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "gtpase reaction" ; rdfs:subClassOf obo:MI_0881 . obo:MI_0884 obo:IAO_0000115 "Epitope tag derived from vesicular stomatitis virus (VSV) glycoprotein. The tag sequence is YTDIEMNRLGK and many antibodies against it are commercially available." ; oboInOwl:hasExactSynonym "vesicular stomatitis virus tag" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0884" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "vsv tag" ; rdfs:subClassOf obo:MI_0507 . obo:MI_0885 obo:IAO_0000115 "Name and details of a journal from which paper has been taken." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0885" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "journal" ; rdfs:subClassOf obo:MI_1093 . obo:MI_0886 obo:IAO_0000115 "Year of publication of a paper." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0886" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "publication year" ; rdfs:subClassOf obo:MI_1093 . obo:MI_0887 obo:IAO_0000115 "In histone acetylation the histones are acetylated on lysine residues in the N-terminal tail as part of gene regulation. Typically, these reactions are catalyzed by enzymes with \"histone acetyltransferase\" (HAt)" ; oboInOwl:hasExactSynonym "HAt", "hat" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:hasRelatedSynonym "histone acetylation" ; oboInOwl:id "MI:0887" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "histone acetylase assay" ; rdfs:subClassOf obo:MI_0889 . obo:MI_0888 obo:IAO_0000115 "During a SANS experiment a beam of neutrons is directed at a sample. The neutrons are elastically scattered by a sample and the resulting scattering pattern is analyzed to provide information about the size, shape and orientation of some component of the sample." ; oboInOwl:hasExactSynonym "SANS", "sans" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0888" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "small angle neutron scattering" ; rdfs:subClassOf obo:MI_0013 . obo:MI_0889 obo:IAO_0000115 "Measures the catalysis of the addition of an acetyl group to a target molecule." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:hasRelatedSynonym "acetylation" ; oboInOwl:id "MI:0889" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "acetylase assay" ; rdfs:subClassOf obo:MI_0415 . obo:MI_0890 obo:IAO_0000115 "Qdot are nanocrystals fluorophores . Nanocrystals a are extremely efficient materials for generating and they have a highly customizable surface for directing their bioactivity, producing a fluorescent probe that outperforms traditional dyes in many fluorescence applications." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0890" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "qdot" ; rdfs:subClassOf obo:MI_0857 . obo:MI_0891 obo:IAO_0000115 "Analysis of diffraction pattern of a partially ordered sample composed of fibers oriented parallel to each other using neutron beam." ; oboInOwl:hasExactSynonym "neutron fiber diff" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0891" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "neutron fiber diffraction" ; rdfs:subClassOf obo:MI_0013 . obo:MI_0892 obo:IAO_0000115 "Assay where at least one molecule under analysis is bound to a solid surface, such as a microplate wall or the sides of a tube, the other reactants being free in solution." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0892" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "solid phase assay" ; rdfs:subClassOf obo:MI_0400 . obo:MI_0893 obo:IAO_0000115 "Analysis of diffraction pattern using neutron beam" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0893" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "neutron diffraction" ; rdfs:subClassOf obo:MI_0013 . obo:MI_0894 obo:IAO_0000115 "Analysis of diffraction pattern using electron beam." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0894" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "electron diffraction" ; rdfs:subClassOf obo:MI_0013 . obo:MI_0895 obo:IAO_0000115 "This method uses Renilla luciferase (Rluc)-based protein fragment complementation assay (PCA) that is designed specifically to investigate dynamic protein complexes (association and dissociation). It is chose to generate a PCA based on the Rluc, which is, because of its simplicity and sensitivity, a widely used bioluminescence reporter. The general scheme for construction and detection of the Rluc-PCA PKA sensor consists of fusing complementary fragments of Rluc to the regulatory (Reg) and catalytic (Cat) PKA subunits of PKA." ; oboInOwl:hasExactSynonym "pka complementation" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0895" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "protein kinase A complementation" ; rdfs:subClassOf obo:MI_0090 . obo:MI_0896 obo:IAO_0000115 "Renilla luciferase, is an enzyme of the sea pansy catalyzing the oxidation of the coelenterazine pigment) that produces light. Renilla luciferase produces a blue light of 480nm." ; oboInOwl:hasExactSynonym "renilla luciferase" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0896" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "renilla luciferase protein tag" ; rdfs:subClassOf obo:MI_1205 . obo:MI_0897 obo:IAO_0000115 "Catalogue of covalent modification of, or a change resulting in an alteration of the measured molecular mass of, a peptide or protein amino acid residue." ; oboInOwl:hasDbXref "id-validation-regexp:" ; oboInOwl:hasExactSynonym "psi-mod" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0897" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "protein modification ontology" ; rdfs:subClassOf obo:MI_0447 . obo:MI_0898 obo:IAO_0000115 "Molecule that is reported to self-interact but the experimental condition does not allow to resolve whether the interaction is intramolecular (true self interaction) or intermolecular (homodimer)." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0898" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "putative self" ; rdfs:subClassOf obo:MI_0495, obo:MI_0500 . obo:MI_0899 obo:IAO_0000115 "pIII is one of the minor coat proteins that decorates in five copies the emerging tip of filamentous phage. Similarly to pVIII pIII also tolerates peptide insertions at the amino-terminus. The sequences to be displayed can either be encoded in the phage copy of the coat gene or in an extra pIII gene copy carried on a phagemid. In the first case 5 copies o the hybrid proteins are displayed while in the latter only a few capsid display one copy and the majority display none. Because of the low copy number pIII display is often referred to as low valency display." ; oboInOwl:hasExactSynonym "low valency display", "p3 filamentous phage" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0899" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "p3 filamentous phage display" ; rdfs:subClassOf obo:MI_0048 . obo:MI_0900 obo:IAO_0000115 "pVIII is the major coat protein of filamentous phage. Its amino-terminus is exposed to solvent and tolerates the insertion of relatively large peptide fragments. By inserting the peptide coding sequence into the phage copy of the pVIII gene up to 3000 copies of the hybrid proteins can be displayed along the phage capsid. Alternatively the hybrid protein can be encoded on a phagemid that is incorporated in a virus like particle by infection with a helper phage. In this latter case one obtains a chimeric capsid where hybrid proteins are interspersed at different density in an otherwise wild type coat. Because of the high copy number pVIII display is also referred to as high valency display." ; oboInOwl:hasExactSynonym "high valency display", "p8 filamentous phage" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0900" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "p8 filamentous phage display" ; rdfs:subClassOf obo:MI_0048 . obo:MI_0901 obo:IAO_0000115 "Exposed amino acid residues undergo a rapid exchange of a specific radio-isotope e.g. hydrogen/deuterium. Residues involved in a molecular interaction are protected from this exchange and exhibit a much slower rate of exchange. This method of binding range identification must be coupled to NMR or mass spectrometry technologies in order to detect the radio-isotope exchange." ; oboInOwl:hasExactSynonym "isotope footprinting" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0901" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "isotope label footprinting" ; rdfs:subClassOf obo:MI_0605 . obo:MI_0902 obo:IAO_0000115 "Any process by which an RNA molecule is cleaved at specific sites or in a regulated manner." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0902" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "rna cleavage" ; rdfs:subClassOf obo:MI_0910 . obo:MI_0903 obo:IAO_0000115 "The microbial protein-protein interactions database (MPDIB) aims to collect and provide all known physical prokaryotic interactions. Note as of 2013, this database is no longer active, but all IMEx curation was imported and is now maintained by the IntAct database (www.ebi.ac.uk/intact)." ; oboInOwl:hasExactSynonym "MPDIB" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0903" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "mpidb" ; rdfs:subClassOf obo:MI_0461, obo:MI_0973 . obo:MI_0904 obo:IAO_0000115 "A polysaccharide is a complex polymer of carbohydrate monormers. They are polymers made up of many monosaccharides joined together by glycosidic bonds. They are therefore very large, often branched, macromolecules." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0904" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "polysaccharide" ; rdfs:subClassOf obo:MI_1100 . obo:MI_0905 obo:IAO_0000115 "AlphaScreen relies on the use of Donor and Acceptor beads that are coated with a layer of hydrogel providing functional groups for bioconjugation. When a biological interaction between molecules brings the beads into proximity, a cascade of chemical reactions is initiated to produce a greatly amplified signal. Upon laser excitation, a photosensitizer in the Donor bead converts ambient oxygen to a more excited singlet state. The singlet state oxygen molecules diffuse across to react with a chemiluminescer in the Acceptor bead that further activates fluorophores contained within the same bead. The fluorophores subsequently emit light at 520-620 nm. In the absence of a specific biological interaction, the singlet state oxygen molecules produced by the Donor bead go undetected without the close proximity of the Acceptor bead. AlphaScreen has successfully been developed for enzyme assays (kinase, helicase, protease, ...), interaction assays (ligand/receptor, protein/protein, protein/DNA), immunoassays, and GPCR functional assays (cAMP, IP3)." ; oboInOwl:hasExactSynonym "AlphaScreen", "alpha-screen" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0905" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "amplified luminescent proximity homogeneous assay" ; rdfs:subClassOf obo:MI_0051 . obo:MI_0906 obo:IAO_0000115 "The protein of interest is expressed as a fusion to the peptide DTYRYI for which antibodies are commercially available." ; oboInOwl:hasExactSynonym "DTYRYI epitope tag" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0906" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "au1 tag" ; rdfs:subClassOf obo:MI_0507 . obo:MI_0907 obo:IAO_0000115 "Statement about the native/denatured conformation of the protein." ; oboInOwl:hasExactSynonym "conformation" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0907" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "conformational status" ; rdfs:subClassOf obo:MI_0346, [ a owl:Class ; owl:unionOf (obo:MI_0908 obo:MI_0909 ) ] . obo:MI_0908 obo:IAO_0000115 "Altered conformation state of the protein as a result of heat or chemical modification resulting in a changed structure of the protein." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0908" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "denatured" ; rdfs:subClassOf obo:MI_0907 . obo:MI_0909 obo:IAO_0000115 "State of the protein without interference i.e. the natural form." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0909" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "native" ; rdfs:subClassOf obo:MI_0907 . obo:MI_0910 obo:IAO_0000115 "Covalent bond breakage of a nucleic acid molecule leading to the formation of smaller fragments." ; oboInOwl:hasExactSynonym "ncl acid cleavage" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0910" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "nucleic acid cleavage" ; rdfs:subClassOf obo:MI_0194 . obo:MI_0911 obo:IAO_0000115 "A variety of crosslinkers are used to analyze subunit structure of proteins, protein interactions and various parameters of protein function. Subunit structure is deduced since crosslinkers only bind surface amino residues in relatively close proximity in the native state. Protein interactions are often too weak or transient to be easily detected, but by crosslinking, the interactions can be captured and analyzed." ; oboInOwl:hasExactSynonym "crosslinker" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0911" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "cross linker" ; rdfs:subClassOf obo:MI_0505 . obo:MI_0912 obo:IAO_0000115 """N -Succinimidyl 3-(2-pyridyldithio)-propionate, is heterobifunctional, thiol-cleavable and membrane permeable crosslinkers. It contains an amine-reactive N-hydroxysuccinimide (NHS) ester that will react with lysine residues to form a stable amide bond. The other end of the spacer arm is terminated in the pyridyl disulfide group that will react with sulfhydryls to form a reversible disulfide bond.""" ; oboInOwl:hasExactSynonym "N -Succinimidyl 3-(2-pyridyldithio)-propionate" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0912" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "spdp cross linker" ; rdfs:subClassOf obo:MI_0911 . obo:MI_0913 obo:IAO_0000115 """Succinimidyl 6-(3-[2-pyridyldithio]-propionamido)hexanoate, is an heterobifunctional, thiol-cleavable and membrane permeable crosslinkers. It contains an amine-reactive N-hydroxysuccinimide (NHS) ester that will react with lysine residues to form a stable amide bond. The other end of the spacer arm is terminated in the pyridyl disulfide group that will react with sulfhydryls to form a reversible disulfide bond. LC-SPDP is a derivative of the classical SPDP with a longer spacer arm.""" ; oboInOwl:hasExactSynonym "Succinimidyl 6-(3-[2-pyridyldithio]-propionamido)hexanoate" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0913" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "lc-spdp cross linker" ; rdfs:subClassOf obo:MI_0912 . obo:MI_0914 obo:IAO_0000115 "Interaction between molecules that may participate in formation of one, but possibly more, physical complexes. Often describes a set of molecules that are co-purified in a single pull-down or coimmunoprecipitation but might participate in formation of distinct physical complexes sharing a common bait." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0914" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "association" ; rdfs:subClassOf obo:MI_2232 . obo:MI_0915 obo:IAO_0000115 "Interaction between molecules within the same physical complex. Often identified under conditions which suggest that the molecules are in close proximity but not necessarily in direct contact with each other." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0915" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "physical association" ; rdfs:subClassOf obo:MI_0914 . obo:MI_0916 obo:IAO_0000115 "Yeast two-hybrid system using Escherichia coli LexA amino acids 1-202 as the DNA-binding domain (BD), and a transcriptional activation domain from the herpes simplex virus protein VP16 (either aa 411-490 or aa 411-455) that can specifically activate transcription of a reporter gene located downstream." ; oboInOwl:hasExactSynonym "LexA VP16 transcription complementation", "lexa vp16 complement" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0916" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "lexa vp16 complementation" ; rdfs:subClassOf obo:MI_0018 . obo:MI_0917 obo:IAO_0000115 "Knowledgebase of the extracellular matrix storing experimentally determined interactions involving extracellular biomolecules. It includes protein-protein, protein-polysaccharide, and protein-lipid interactions." ; oboInOwl:hasDbXref "search-url:" ; oboInOwl:hasExactSynonym "MatrixDB" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0917" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "matrixdb" ; rdfs:subClassOf obo:MI_0461, obo:MI_0973 . obo:MI_0918 obo:IAO_0000115 "Molecule which emits active chemical groups, electrons or ions that are transfered to an acceptor molecule." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0918" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "donor" ; rdfs:subClassOf obo:MI_0500 . obo:MI_0919 obo:IAO_0000115 "Molecule able to receive active chemical groups, electrons or ions from a donor molecule." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0919" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "acceptor" ; rdfs:subClassOf obo:MI_0500 . obo:MI_0920 obo:IAO_0000115 "Measures the catalysis of the hydrolysis of phosphodiester bonds in chains of RNA." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0920" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "ribonuclease assay" ; rdfs:subClassOf obo:MI_1034 . obo:MI_0921 obo:IAO_0000115 "This array technology allows the screening of binding abilities of hundreds or thousands of biomolecules (small molecule, peptide, protein, sugar, lipid, nucleic acid, and their fragments) printed onto the gold-coated chip by using an instrument (micro-arrayer) that is capable of spotting liquid samples in a reproducible manner onto a planar support. The ordered protein array can then be probed with a non-labelled sample (small molecule, peptide, protein, sugar, lipid, nucleic acid, and their fragments) to identify the baits that can bind to it. This is done in real time, allowing direct measurement of both the on-rate and the off-rate and of the affinity constant of complex formation on each spot." ; oboInOwl:hasExactSynonym "Biacore Flexchip(r)", "SPRImager", "SPRi-Plex ", "spr array" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0921" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "surface plasmon resonance array" ; rdfs:subClassOf obo:MI_0008, obo:MI_0107 . obo:MI_0922 obo:IAO_0000115 "Experimental evidence supporting an interaction curated and released under the IMEx agreement." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0922" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "imex evidence" ; rdfs:subClassOf obo:MI_0353 . obo:MI_0923 obo:IAO_0000115 """iRefIndex provides an index of protein interactions available in a number of primary interaction databases including BIND, BioGRID, DIP, HPRD, IntAct, MINT, MPact, MPPI and OPHID. This index allows the user to search for a protein and retrieve a non-redundant list of interactors for that protein. iRefIndex uses the Sequence Global Unique Identifier (SEGUID) to group proteins and interactions into redundant groups. This method allows users to integrate their own data with the iRefIndex in a way that ensures proteins with the exact same sequence will be represented only once. http://irefindex.uio.no/""" ; oboInOwl:hasExactSynonym "iRefIndex" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0923" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "irefindex" ; rdfs:subClassOf obo:MI_0461, obo:MI_0489 . obo:MI_0924 obo:IAO_0000115 """Camjedb is a comprehensive database for information on the genome of Campylobacter jejuni. http://www.sanger.ac.uk/Projects/C_jejuni/""" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0924" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "camjedb" ; rdfs:subClassOf obo:MI_1094 . obo:MI_0925 obo:IAO_0000115 "Post translational modification observed on a protein in the context of an interaction." ; oboInOwl:hasExactSynonym "observed ptm", "observed-ptm" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0925" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "observed-ptm" ; rdfs:subClassOf obo:MI_0668 . obo:MI_0926 obo:IAO_0000115 "This fluorescent label is a small ligand membrane-permeant and nonfluorescent until it binds with high affinity and specificity to the tetracysteine domain. Such in situ labeling adds much less mass than does green fluorescent protein and offers greater versatility in attachment sites as well as potential spectroscopic and chemical properties." ; oboInOwl:hasExactSynonym "4',5'-bis(1,3,2-dithioarsolan-2-yl)fluorescein ", "FIAsH label" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0926" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "fiash label" ; rdfs:subClassOf obo:MI_0857 . obo:MI_0927 obo:IAO_0000115 "IAEDANS is fluorescent tag that bind to cysteines. IAEDANS is the acronyme of (5((((2-iodoacetyl)amino)ethyl)amino)-naphthalene-1-sulfonic acid) with free SH groups." ; oboInOwl:hasExactSynonym "(5((((2-iodoacetyl)amino)ethyl)amino)-naphthalene-1-sulfonic acid) ", "1,5-IAEDANS", "IAEDANS" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0927" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "iaedans label" ; rdfs:subClassOf obo:MI_0857 . obo:MI_0928 obo:IAO_0000115 "Biomolecules are mixed in a buffer and the resulting mixture is passed through a filter. Large aggregates are retained on the filter and the pariticipants may then be identified." ; oboInOwl:hasExactSynonym "Filter retention assay", "filter binding" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:hasRelatedSynonym "filter retardation assay", "membrane filtration" ; oboInOwl:id "MI:0928" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "filter trap assay" ; rdfs:subClassOf obo:MI_0013, obo:MI_0091 . obo:MI_0929 obo:IAO_0000115 """A standard procedure to identify RNA fragments containing specific sequences. In this procedure RNA fragments are separated by electrophoresis, the fragments are transferred to a membrane and the membrane is incubated with a radio labelled probe that hybridises any complementary subsequence.""" ; oboInOwl:hasExactSynonym "northen" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0929" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "northern blot" ; rdfs:subClassOf obo:MI_0078 . obo:MI_0930 obo:IAO_0000115 """An effect in which individual perturbations of two different genes result in different mutant phenotypes, and the resulting phenotype of their combination (the double mutant) is equal to that of only one of the perturbations. With respect to any single quantifiable phenotype, this may be expressed as an inequality as: (a != wt AND b != wt AND a != b) AND (ab = a OR ab = b) where 'a' and 'b' are the observed phenotype values of the individual perturbations, 'ab' is the observed phenotype value of the double perturbation, 'wt' is the wild type phenotype value and 'a != b' indicates qualitatively or quantitatively different phenotypes.""" ; oboInOwl:hasExactSynonym "epistatic genetic interaction" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0930" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "epistatis" ; owl:deprecated true . obo:MI_0931 obo:IAO_0000115 "Two genes A and B present an genetic interaction defined by inequality if the phenotypes of the two single mutants a and b, the double mutant ab and the wild-type WT can be measured quantitatively and described relative to each other by an inequality relationship." ; oboInOwl:hasExactSynonym "genetic inequality" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0931" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "genetic interaction defined by inequality" ; owl:deprecated true . obo:MI_0932 obo:IAO_0000115 "The observation that, when tested, no interaction was observed between two or more genes, for a given phenotype. In other words, the phenotype of the combined perturbations a and b result in the expected phenotype." ; oboInOwl:hasExactSynonym "expected multigenic phenotypic result", "neutral genetic interaction", "noninteractive", "noninteractive genetic interaction (sensu inequality)", "noninteractive genetic interaction defined by inequality" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0932" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "neutral multigenic phenotype result" ; rdfs:subClassOf obo:MI_2366 . obo:MI_0933 obo:IAO_0000115 """An effect in which two genetic perturbations, when combined, result in a phenotype that is more severe/penetrant than expected given the phenotypes of the individual perturbations. With respect to any single quantifiable phenotype, this may be expressed as an inequality as: ab < E <= wt OR wt <= E < ab where 'ab' is the observed phenotype value of the double perturbation, 'E' is the expected phenotype value of the double perturbation, and 'wt' is the wild type phenotype value.""" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0933" ; a owl:Class ; rdfs:label "diverging genetic interaction" ; rdfs:subClassOf obo:MI_0208 . obo:MI_0934 obo:IAO_0000115 """OBSOLETE: An effect in which the observed phenotype of individual perturbations and/or the double perturbation collectively exhibit values both greater than AND less than wild type (on the same scale). Alternatively, this could describe a scenario in which individual perturbations result in qualitatively different phenotypes. With respect to any single quantifiable phenotype, this may be expressed as an inequality as: a < wt < b [ab != E] OR With respect to two qualitatively different phenotypes, this may be expressed as an inequality as: (a != wt AND b != wt AND a != b) where 'a' and 'b' are the observed phenotype values of the individual perturbations, 'ab' is the observed phenotype value of the double perturbation, 'E' is the expected phenotype value of the double perturbation, 'wt' is the wild type phenotype value and 'a != b' indicates qualitatively different phenotypes.""" ; oboInOwl:hasExactSynonym "neutral gent int" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0934" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "obsolete neutral genetic interaction" ; owl:deprecated true . obo:MI_0935 obo:IAO_0000115 """An effect in which two genetic perturbations, when combined, result in a phenotype that is less severe/penetrant than would be expected from the original phenotypes, in effect making the organism more \"wild type\" in character with regards to the phenotype in question. With respect to any single quantifiable phenotype, this may be expressed as an inequality as: E < ab <= wt OR wt <= ab < E where 'ab' is the observed phenotype value of the double perturbation, 'E' is the expected phenotype value of the double perturbation, and 'wt' is the wild type phenotype value.""" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0935" ; a owl:Class ; rdfs:label "converging genetic interaction" ; rdfs:subClassOf obo:MI_0208 . obo:MI_0936 obo:IAO_0000115 """The Electron Microscopy Data Bank (EMDB) contains experimentally determined three-dimensional maps and associated experimental data and files. https://www.ebi.ac.uk/emdb""" ; oboInOwl:hasDbXref "search-url:" ; oboInOwl:hasExactSynonym "Electron Microscopy Data Bank", "eMDB" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0936" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "emdb" ; rdfs:subClassOf obo:MI_0472 . obo:MI_0937 obo:IAO_0000115 "This peptide is a 314 to 319 amino acids fragment of the middle T antigen of mouse polymavirus. Glu-Glu epitope peptide." ; oboInOwl:hasExactSynonym "glu tag" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0937" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "glu tag" ; rdfs:subClassOf obo:MI_0507 . obo:MI_0938 obo:IAO_0000115 "Characterization of viscoelastic properties of biomolecule solution is used to infer interactions between molecules." ; oboInOwl:hasExactSynonym "rheology" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0938" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "rheology measurement" ; rdfs:subClassOf obo:MI_0013 . obo:MI_0939 obo:IAO_0000115 "Fluorescence label used to monitor the presence of a protein." ; oboInOwl:hasExactSynonym "fluorescein" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0939" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "fluorescein label" ; rdfs:subClassOf obo:MI_0857 . obo:MI_0940 obo:IAO_0000115 "Fluorescein-5-maleimide is one of the most popular fluorescent dyes for thiol modifications of proteins at cysteine residues that either are intrinsically present or result from reduction of cystines. Unlike iodoacetamides, maleimides do not react with histidines and methionines under physiological conditions." ; oboInOwl:hasExactSynonym "fluor-5-maleimide" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0940" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "fluorescein-5-maleimide label" ; rdfs:subClassOf obo:MI_0939 . obo:MI_0941 obo:IAO_0000115 "Binds to an interacting molecule in competition with other interaction candidates, for example at a shared binding site." ; oboInOwl:hasExactSynonym "competitor" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0941" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "competitor" ; rdfs:subClassOf obo:MI_0500 . obo:MI_0942 obo:IAO_0000115 """Based on NCBO Taxonomy but adapted for UniProt http://www.uniprot.org/taxonomy/""" ; oboInOwl:hasDbXref "id-validation-regexp:", "search-url:" ; oboInOwl:hasExactSynonym "uniprot taxon" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0942" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "uniprot taxonomy" ; rdfs:subClassOf obo:MI_0473 . obo:MI_0943 obo:IAO_0000115 "'Study of interactions by an analytical technique based on measurements of mass-to-charge ratio of charged particles in a mass spectrometer." ; oboInOwl:hasExactSynonym "ms interact detect" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0943" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "detection by mass spectrometry" ; rdfs:subClassOf obo:MI_0013 . obo:MI_0944 obo:IAO_0000115 "Mass spectroscopy based measurement of the rate and/or extent of the hydrogen/deuterium exchange." ; oboInOwl:hasExactSynonym "h1-h2 ms" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0944" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "mass spectrometry study of hydrogen/deuterium exchange" ; rdfs:subClassOf obo:MI_0943 . obo:MI_0945 obo:IAO_0000115 "An oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced." ; oboInOwl:hasExactSynonym "redox reaction" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0945" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "oxidoreductase activity electron transfer reaction" ; rdfs:subClassOf obo:MI_0414 . obo:MI_0946 obo:IAO_0000115 "Combines on-chip in-vitro protein synthesis with an in situ microfluidic affinity assay. Co-spotted DNA microarray containing a linear template encoding the proteins is aligned and bonded with a microfluidic device that creates chambers in the array chip. The experiment consists of three main stages: (i) an antibody that recognizes the bait protein or a specific tag is deposited on a circular area inside each individual chamber; (ii) proteins are expressed in vitro by transcription and translation of DNA spotted on the chip; (iii) the bait is immobilized on the chamber surface by the antibody and the chamber is washed, retaining only interacting bait-prey pairs." ; oboInOwl:hasExactSynonym " protein interaction network generator", "MITOMI", "mIP", "ping" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0946" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "miniaturized immunoprecipitation" ; rdfs:subClassOf obo:MI_0019, obo:MI_0092 . obo:MI_0947 obo:IAO_0000115 "Binding of proteins bound to beads leads to a measurable aggregation of the beads." ; oboInOwl:hasExactSynonym "bead aggregation" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0947" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "bead aggregation assay" ; rdfs:subClassOf obo:MI_0892 . obo:MI_0948 obo:IAO_0000115 "A brief description (such as temp, pH) of the conditions under which a kinetic measurment has been performed." ; oboInOwl:hasExactSynonym "kinetic_conditions" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0948" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "kinetic conditions" ; rdfs:subClassOf obo:MI_0664 . obo:MI_0949 obo:IAO_0000115 """Experiments monitoring interactions of GTP-GDP exchange factors with their cognate GTPases.""" ; oboInOwl:hasExactSynonym "gdp_gtp exchange", "gtp/gdp exchange", "guanine nucleotide exchange assay" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0949" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "gdp/gtp exchange assay" ; rdfs:subClassOf obo:MI_1036 . obo:MI_0950 obo:IAO_0000115 "Permits the identification of substrates of enzymes by mutating residues, usually in the active site such that the enzyme will bind but not act on its substrate." ; oboInOwl:hasExactSynonym "trap-mutant" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0950" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "trapping mutant" ; rdfs:subClassOf obo:MI_0505 . obo:MI_0951 obo:IAO_0000115 "Reference to the master sequence from which this chain has been derived." ; oboInOwl:hasExactSynonym "chain-parent" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0951" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "chain parent sequence reference" ; rdfs:subClassOf obo:MI_0353 . obo:MI_0952 obo:IAO_0000115 "Deprecated IMEx identifiers should be exchanged in IMEx records and stored as cross reference with this qualifier." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0952" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "imex secondary" ; rdfs:subClassOf obo:MI_0353 . obo:MI_0953 obo:IAO_0000115 "Interaction inferred by monitoring polymerization/depolymerization of an interactor" ; oboInOwl:hasExactSynonym "polymerization" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0953" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "polymerization" ; rdfs:subClassOf obo:MI_0401 . obo:MI_0954 obo:IAO_0000115 "An assessment of the depth and extent to which a paper has been curated" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0954" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "curation quality" ; rdfs:subClassOf obo:MI_0000 . obo:MI_0955 obo:IAO_0000115 "Assessment of the depth to which a paper has been curated" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0955" ; a owl:Class ; rdfs:label "curation depth" ; rdfs:subClassOf obo:MI_0954 . obo:MI_0956 obo:IAO_0000115 "Assessment to the extent of interactions captured in this paper" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0956" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "curation coverage" ; rdfs:subClassOf obo:MI_0954 . obo:MI_0957 obo:IAO_0000115 "All interactions which can be ascribed to an unambiguous identified in this paper have been captured." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0957" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "full coverage" ; rdfs:subClassOf obo:MI_0956 . obo:MI_0958 obo:IAO_0000115 "Not all interactions which can be ascribed to an unambiguous identified in this paper have been captured." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0958" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "partial coverage" ; rdfs:subClassOf obo:MI_0956 . obo:MI_0959 obo:IAO_0000115 "Paper has been curated to full IMEx specifications" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0959" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "imex curation" ; rdfs:subClassOf obo:MI_0955 . obo:MI_0960 obo:IAO_0000115 "Paper has been curated to meet MIMIx specifications" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0960" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "mimix curation" ; rdfs:subClassOf obo:MI_0955 . obo:MI_0961 obo:IAO_0000115 "Minimal interaction data has been extracted from the paper" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0961" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "rapid curation" ; rdfs:subClassOf obo:MI_0955 . obo:MI_0962 obo:IAO_0000115 "The protein of interest is expressed with a StrepII fusion peptide Ser-Ala-Trp-Ser-His-Pro-Gln-Phe-Glu-Lys (SAWSHPQFEK)." ; oboInOwl:hasExactSynonym "Strep (II)", "Strep II" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0962" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "strep ii tag" ; rdfs:subClassOf obo:MI_0507 . obo:MI_0963 obo:IAO_0000115 "A specific pull down method where the protein of interest (bait) is endogenously expressed with at least two affinity tags (GFP, FLAG or others). The bait is purified in parallel using different purification protocols in contrast to tandem affinity purification (TAP) (publication currently in press)." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2009-05-14T10:56:21Z" ; oboInOwl:hasExactSynonym "ipac" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0963" ; a owl:Class ; rdfs:label "interactome parallel affinity capture" ; rdfs:subClassOf obo:MI_0096 . obo:MI_0964 obo:IAO_0000115 "Subset of spectroscopy that deals with the infrared region of the electromagnetic spectrum." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2009-10-28T10:55:01Z" ; oboInOwl:hasExactSynonym "ir spectrometry" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0964" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "infrared spectroscopy" ; rdfs:subClassOf obo:MI_0013 . obo:MI_0965 obo:IAO_0000115 "Two-dimensional infrared correlation spectroscopy analysis is the application of 2D correlation analysis on infrared spectra. 2D IR spectroscopy probes molecular structures by means of vibrational frequencies, couplings, and transition dipole angles." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2009-10-28T11:05:01Z" ; oboInOwl:hasExactSynonym "2d-ir" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0965" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "2d-infrared spectrometry" ; rdfs:subClassOf obo:MI_0964 . obo:MI_0966 obo:IAO_0000115 "Ultraviolet-visible spectroscopy or ultraviolet-visible spectrophotometry (UV-Vis or UV/Vis) involves the spectroscopy of photons in the UV-visible region. This means it uses light in the visible and adjacent (near ultraviolet (UV) and near infrared (NIR)) ranges." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2009-10-28T11:12:27Z" ; oboInOwl:hasExactSynonym "UV/Vis", "ultraviolet-visible spectrophotometry", "uv-vis" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0966" ; a owl:Class ; rdfs:label "ultraviolet-visible spectroscopy" ; rdfs:subClassOf obo:MI_0013 . obo:MI_0967 obo:IAO_0000115 "ChEMBL focuses on mapping the interactions of small molecules binding to their macromolecular targets." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2009-10-28T11:20:55Z" ; oboInOwl:hasDbXref "id-validation-regexp:", "search-url:" ; oboInOwl:hasExactSynonym "chembl" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0967" ; oboInOwl:inSubset mi:Drugable, mi:PSI-MI_slim ; a owl:Class ; rdfs:label "chembl compound" ; rdfs:subClassOf obo:MI_1349, obo:MI_2054 . obo:MI_0968 obo:IAO_0000115 "A biosensor is a device for the detection of an analyte that combines a biological component with a physicochemical detector component" ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2009-10-28T11:44:32Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0968" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "biosensor" ; rdfs:subClassOf obo:MI_0013 . obo:MI_0969 obo:IAO_0000115 "BLI is an optical analytical technique that analyzes the interference pattern of white light reflected from two surfaces: a layer of immobilized protein on the biosensor tip, and an internal reference layer" ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2009-10-28T11:48:40Z" ; oboInOwl:hasExactSynonym "bli" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0969" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "bio-layer interferometry" ; rdfs:subClassOf obo:MI_0968 . obo:MI_0970 obo:IAO_0000115 "InChIKeys consist of 14 characters resulting from a hash of the connectivity information of the InChI, followed by a hyphen, followed by 9 characters resulting from a hash of the remaining layers of the InChI, followed by a single character indication the version of InChI used, another hyphen, followed by single checksum character" ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2009-10-28T01:13:25Z" ; oboInOwl:hasExactSynonym "inchi key" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0970" ; oboInOwl:inSubset mi:Drugable ; a owl:Class ; rdfs:label "inchi key" ; rdfs:subClassOf obo:MI_1212, obo:MI_2091 . obo:MI_0971 obo:IAO_0000115 "The posttranslational phosphopantetheinylation of peptidyl-serine to form peptidyl-O-phosphopantetheine-L-serine." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2009-10-28T01:20:40Z" ; oboInOwl:hasExactSynonym "p_patetheinylation" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0971" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "phosphopantetheinylation" ; rdfs:subClassOf obo:MI_0414 . obo:MI_0972 obo:IAO_0000115 "Assay of the posttranslational phosphopantetheinylation of peptidyl-serine to form peptidyl-O-phosphopantetheine-L-serine." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2009-10-28T01:23:19Z" ; oboInOwl:hasExactSynonym "p_pantethinyl assay" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:hasRelatedSynonym "phosphopantetheinylation" ; oboInOwl:id "MI:0972" ; a owl:Class ; rdfs:label "phosphopantetheinylase assay" ; rdfs:subClassOf obo:MI_0415 . obo:MI_0973 obo:IAO_0000115 "Databases that contain curated experimental interaction data and exchanging it with other IMEx databases." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2009-12-18T10:24:37Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0973" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "imex source" ; rdfs:subClassOf obo:MI_0489 . obo:MI_0974 obo:IAO_0000115 "Human and mouse experimentally verified interactions and pathways involved in innate immunity." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2010-04-09T03:11:54Z" ; oboInOwl:hasExactSynonym "InnateDB" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0974" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "innatedb" ; rdfs:subClassOf obo:MI_0461, obo:MI_0973 . obo:MI_0975 obo:IAO_0000115 "A fusion protein tag consisting of a portion of the constant region of IgG." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2010-04-21T02:18:04Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0975" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "fc-igg tag" ; rdfs:subClassOf obo:MI_0240 . obo:MI_0976 obo:IAO_0000115 "Used to study surface-associated interactions at the molecular level. In this method, the evanescent field from an internally reflected excitation source selectively excites fluorescent molecules on or near a surface." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2010-04-21T02:30:46Z" ; oboInOwl:hasExactSynonym "tirfs" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0976" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "total internal reflection fluorescence spectroscopy" ; rdfs:subClassOf obo:MI_0051 . obo:MI_0977 obo:IAO_0000115 "Prevents export of experiment and associated interactions to IMEx" ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2010-04-21T02:49:48Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0977" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "no-imex-export" ; rdfs:subClassOf obo:MI_0665 . obo:MI_0978 obo:IAO_0000115 "Author given name for a participant, not commonly found in source databases." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2010-04-21T02:55:39Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0978" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "author-name" ; rdfs:subClassOf obo:MI_0666 . obo:MI_0979 obo:IAO_0000115 "Catalysis of oxido-reductions. The substrate oxidized is regarded as the hydrogen or electron donor. The classification is based on 'donor:acceptor oxidoreductase'. The common name is 'dehydrogenase', wherever this is possible; as an alternative, 'acceptor reductase' can be used. 'Oxidase' is used only where O2 is an acceptor." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2010-04-21T03:04:54Z" ; oboInOwl:hasExactSynonym "oxidoreduct assay" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0979" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "oxidoreductase assay" ; rdfs:subClassOf obo:MI_0415 . obo:MI_0980 obo:IAO_0000115 "The protein is expressed as a hybrid protein fused to a tag containing an enzyme activity e.g. peroxidase. Subsequence observation or measurement of enzyme activity is used to identify the presence of the molecule in an interaction." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2010-04-21T03:18:09Z" ; oboInOwl:hasExactSynonym "tag enzyme assay" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0980" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "tag visualisation by enzyme assay" ; rdfs:subClassOf obo:MI_0866 . obo:MI_0981 obo:IAO_0000115 "The protein is expressed as a hybrid protein fused to a tag containing a peroxidase activity. Subsequent observation or measurement of peroxidase activity is used to identify the presence of the molecule in an interaction." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2010-04-21T03:34:14Z" ; oboInOwl:hasExactSynonym "tag perox activity" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0981" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "tag visualisation by peroxidase activity" ; rdfs:subClassOf obo:MI_0980 . obo:MI_0982 obo:IAO_0000115 "Any method which relies on the motion of particles relative to a matrix under the influence of an electrical field." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2010-04-26T10:30:36Z" ; oboInOwl:hasExactSynonym "electrophoresis" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0982" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "electrophoretic mobility-based method" ; rdfs:subClassOf obo:MI_0401 . obo:MI_0983 obo:IAO_0000115 """GEMMA is a method to study protein complexes in solution: a diluted protein sample is transmitted into the gas phase by a charged reduced electrospray process. The generated particles, each containing one protein molecule with a +1 charge, are separated according to size in a differential mobility analyzer and subsequently quantified by a particle counter. In contrast to mass spectrometry, this method is run at atmospheric pressure and measures the diameter of the particle rather than the mass.""" ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2010-04-26T10:36:41Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0983" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "gemma" ; rdfs:subClassOf obo:MI_0982 . obo:MI_0984 obo:IAO_0000115 "The measurement of the removal of an amine group from a molecule." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2010-04-26T10:45:01Z" ; oboInOwl:hasExactSynonym "aminase assay", "deamination" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0984" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "deamination assay" ; rdfs:subClassOf obo:MI_0415 . obo:MI_0985 obo:IAO_0000115 "The removal of an amine group from a molecule." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2010-04-26T10:49:06Z" ; oboInOwl:hasExactSynonym "deamination" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0985" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "deamination reaction" ; rdfs:subClassOf obo:MI_0414 . obo:MI_0986 obo:IAO_0000115 "The lengthening of a strand of a nucleic acid by the systematic addition of bases by a polymerase." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2010-04-26T10:52:22Z" ; oboInOwl:hasExactSynonym "strand elongation" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0986" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "nucleic acid strand elongation reaction" ; rdfs:subClassOf obo:MI_0414 . obo:MI_0987 obo:IAO_0000115 "The process by which an RNA strand is synthesized from template DNA by the action of polymerases, which add nucleotides to the 3' end of the nascent RNA strand." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2010-04-26T11:00:08Z" ; oboInOwl:hasExactSynonym "rna elongation" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0987" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "rna strand elongation" ; rdfs:subClassOf obo:MI_0986 . obo:MI_0988 obo:IAO_0000115 "Synthetic peptide consisting of 8 amino acids Trp-Ser-His-Pro-Gln-Phe-Glu-Lys (WSHPQFEK)." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2010-04-26T11:07:37Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0988" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "strep tag" ; rdfs:subClassOf obo:MI_0507 . obo:MI_0989 obo:IAO_0000115 "The measurement of the addition of an amine group to a molecule." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2010-04-26T11:20:23Z" ; oboInOwl:hasExactSynonym "amidation" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0989" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "amidase assay" ; rdfs:subClassOf obo:MI_0415 . obo:MI_0990 obo:IAO_0000115 "The cleavage of a biomolecule either into its component parts or sub-parts." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2010-04-26T11:27:22Z" ; oboInOwl:hasExactSynonym "cleavage" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0990" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "cleavage assay" ; rdfs:subClassOf obo:MI_0415 . obo:MI_0991 obo:IAO_0000115 "The cleavage of a lipid molecule from a larger biomolecule." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2010-04-26T11:30:12Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0991" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "lipoprotein cleavage assay" ; rdfs:subClassOf obo:MI_0990 . obo:MI_0992 obo:IAO_0000115 "Measures the removal of S-farnesyl-L-cysteined, which is cleaved and returns a C residue." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2010-04-26T12:27:47Z" ; oboInOwl:hasExactSynonym "defarnesylation assay" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0992" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "defarnesylase assay" ; rdfs:subClassOf obo:MI_0991 . obo:MI_0993 obo:IAO_0000115 "Measures the removal of S-geranylgeranyl-L-cysteine, which is cleaved and returns a C residue." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2010-04-26T12:36:51Z" ; oboInOwl:hasExactSynonym "degeranylation assay" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0993" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "degeranylase assay" ; rdfs:subClassOf obo:MI_0991 . obo:MI_0994 obo:IAO_0000115 "measures the removal of N6-myristoyl-L-lysine, which is cleaved and returns a K residue." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2010-04-26T12:39:30Z" ; oboInOwl:hasExactSynonym "demyristoylation assay" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0994" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "demyristoylase assay" ; rdfs:subClassOf obo:MI_0991 . obo:MI_0995 obo:IAO_0000115 "Measures the removal of S-palmitoyl-L-cysteine, N6-palmitoyl-L-lysine, O-palmitoyl-L-threonine or O-palmitoyl-L-serine, which are cleaved and return C,K,T or S residues." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2010-04-26T12:42:00Z" ; oboInOwl:hasExactSynonym "depalmitoylation assay" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0995" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "depalmitoylase assay" ; rdfs:subClassOf obo:MI_0991 . obo:MI_0996 obo:IAO_0000115 "Measures the removal of N6-formyl-L-lysine, which is cleaved and returns a K residue." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2010-04-26T12:50:38Z" ; oboInOwl:hasExactSynonym "deformylase reaction" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:hasRelatedSynonym "deformylation" ; oboInOwl:id "MI:0996" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "deformylase assay" ; rdfs:subClassOf obo:MI_0415 . obo:MI_0997 obo:IAO_0000115 "Measures the reversible reaction that creates a covalent bond between a C-terminus G of ubiquitin and a K residue of the target." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2010-04-26T12:54:02Z" ; oboInOwl:hasExactSynonym "ubiquitinase assay" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:hasRelatedSynonym "ubiquitination" ; oboInOwl:id "MI:0997" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "ubiquitinase assay" ; rdfs:subClassOf obo:MI_0415 . obo:MI_0998 obo:IAO_0000115 "Measures the cleavage of the G-K bond and release of ubiquitin or ubiquitin like proteins." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2010-04-26T12:56:41Z" ; oboInOwl:hasExactSynonym "deubiquitinase assay" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:hasRelatedSynonym "deubiquinase assay", "deubiquitination" ; oboInOwl:id "MI:0998" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "deubiquitinase assay" ; rdfs:subClassOf obo:MI_0415 . obo:MI_0999 obo:IAO_0000115 "Measurement of the reaction that can affect K or G residues. Reside is functionalised with a formyl group." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2010-04-26T01:01:44Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:0999" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "formylase assay" ; rdfs:subClassOf obo:MI_0415 . obo:MI_1000 obo:IAO_0000115 "Measurement of the irreversible introduction of a hydroxyl group that can affect K,P,Y or R residues." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2010-04-26T01:05:19Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1000" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "hydroxylase assay" ; rdfs:subClassOf obo:MI_0415 . obo:MI_1001 obo:IAO_0000115 "The covalent binding of a lipid group to a peptide chain." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2010-04-26T01:09:49Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:hasRelatedSynonym "lipidation" ; oboInOwl:id "MI:1001" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "lipidase assay" ; rdfs:subClassOf obo:MI_0415 . obo:MI_1002 obo:IAO_0000115 "Measurement of the irreversible covalent addition of a myristoyl group via an amide bond to the alpha-amino group of an amino acid." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2010-04-26T01:16:11Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:hasRelatedSynonym "myristoylation" ; oboInOwl:id "MI:1002" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "myristoylase assay" ; rdfs:subClassOf obo:MI_1001 . obo:MI_1003 obo:IAO_0000115 "Measurement of the attachment of one or two 20-carbon lipophilic geranylgeranyl isoprene units from geranylgeranyl diphosphate to one or more cysteine residue(s)." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2010-04-26T01:20:07Z" ; oboInOwl:hasExactSynonym "geranylgeranylase" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:hasRelatedSynonym "geranylgeranylation" ; oboInOwl:id "MI:1003" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "geranylgeranylase assay" ; rdfs:subClassOf obo:MI_1001 . obo:MI_1004 obo:IAO_0000115 "Measurement of the covalent attachment of palmitic acid to a protein." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2010-04-26T01:27:50Z" ; oboInOwl:hasExactSynonym "palmitoylase assay" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:hasRelatedSynonym "myristoylation" ; oboInOwl:id "MI:1004" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "palmitoylase assay" ; rdfs:subClassOf obo:MI_1001 . obo:MI_1005 obo:IAO_0000115 "Measurement of the addition of one or more ADP-ribose moieties to molecules." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2010-04-26T01:30:24Z" ; oboInOwl:hasExactSynonym "adp ribosylase" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:hasRelatedSynonym "adp ribosylation" ; oboInOwl:id "MI:1005" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "adp ribosylase assay" ; rdfs:subClassOf obo:MI_0415 . obo:MI_1006 obo:IAO_0000115 "Measurement of the removal of a glycosyl residue to one or more monomeric units in a polypeptide, polynucleotide, polysaccharide, or other biological polymer." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2010-04-26T01:34:07Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1006" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "deglycosylase assay" ; rdfs:subClassOf obo:MI_0415 . obo:MI_1007 obo:IAO_0000115 "Measurement of the covalently attachment of glycosyl residues to one or more monomeric units in a polypeptide, polynucleotide, polysaccharide, or other biological polymer." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2010-04-26T01:35:37Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:hasRelatedSynonym "glycosylation" ; oboInOwl:id "MI:1007" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "glycosylase assay" ; rdfs:subClassOf obo:MI_0415 . obo:MI_1008 obo:IAO_0000115 "Measurement of the reversible reaction that creates a covalent bond between a C-terminus G of an ubiquitine like sumo protein and a K residue of the target." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2010-04-26T01:37:31Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:hasRelatedSynonym "sumoylation" ; oboInOwl:id "MI:1008" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "sumoylase assay" ; rdfs:subClassOf obo:MI_0415 . obo:MI_1009 obo:IAO_0000115 "Measurement of the reaction that breaks a covalent bond between a C-terminus G of an ubiquitine like sumo protein and a K residue of the target." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2010-04-26T01:38:56Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:hasRelatedSynonym "desumylation" ; oboInOwl:id "MI:1009" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "desumoylase assay" ; rdfs:subClassOf obo:MI_0415 . obo:MI_1010 obo:IAO_0000115 "Measurement of a reversible reaction that create a covalent bond between a Glycine residue of an ubiquitine like NEDD8 protein and a lysine residue of the target." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2010-04-26T01:41:40Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:hasRelatedSynonym "neddylation" ; oboInOwl:id "MI:1010" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "neddylase assay" ; rdfs:subClassOf obo:MI_0415 . obo:MI_1011 obo:IAO_0000115 "Measurement of the reaction that breaks a covalent bond between a Glycine residue of an ubiquitine like NEDD8 protein and a lysine residue of the target." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2010-04-26T01:42:49Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:hasRelatedSynonym "deneddylation" ; oboInOwl:id "MI:1011" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "deneddylase assay" ; rdfs:subClassOf obo:MI_0415 . obo:MI_1012 obo:IAO_0000115 "38 amino acid (MDEKTTGWRGGHWEGLAGELEQLRARLEHHPQGQREP) Streptavidin binding peptide." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2010-04-29T08:42:26Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:hasRelatedSynonym "steptavidin binding peptide" ; oboInOwl:id "MI:1012" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "sbp" ; rdfs:subClassOf obo:MI_0507 . obo:MI_1013 obo:IAO_0000115 """Genome browser complementary to Ensembl which extends the search space across a broader taxonomic range. http://www.ensemblgenomes.org""" ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2010-05-06T08:09:20Z" ; oboInOwl:hasDbXref "search-url:" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1013" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "ensemblgenomes" ; rdfs:subClassOf obo:MI_1094 . obo:MI_1014 obo:IAO_0000115 "STRING is a database and web resource dedicated to protein interactions, including both physical and functional interactions. It weights and integrates information from numerous sources, including experimental repositories, computational prediction methods and public text collections, thus acting as a meta-database that maps all interaction evidence onto a common set of genomes and proteins." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2010-07-15T11:00:57Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1014" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "string" ; rdfs:subClassOf obo:MI_0461 . obo:MI_1015 obo:IAO_0000115 "dictyBase (http://dictybase.org) is the model organism database for Dictyostelium discoideum. It houses the complete genome sequence, ESTs and the entire body of literature relevant to Dictyostelium. This information is curated to provide accurate gene models and functional annotations, with the goal of fully annotating the genome." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2010-07-29T01:19:40Z" ; oboInOwl:hasDbXref "id-validation-regexp:" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1015" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "dictybase" ; rdfs:subClassOf obo:MI_1094 . obo:MI_1016 obo:IAO_0000115 "Slow rate of FRAP recovery when molecule is bound to another compared to inert, non-binding molecule taken as a measure of an interaction." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2010-11-11T10:39:37Z" ; oboInOwl:hasExactSynonym "frap" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1016" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "fluorescence recovery after photobleaching" ; rdfs:subClassOf obo:MI_0051 . obo:MI_1017 obo:IAO_0000115 "Proteins are crosslinked to nucleic acids, for example by the addition of formaldehyde. RNA sequences that cross-link with a given protein are isolated by immunoprecipitation of the protein, and reversal of the cross-linking permits recovery and quantitative analysis of the immunoprecipitated RNA by reverse transcription PCR." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2010-11-11T10:58:47Z" ; oboInOwl:hasExactSynonym "rna-ip" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:hasRelatedSynonym "rip" ; oboInOwl:id "MI:1017" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "rna immunoprecipitation" ; rdfs:subClassOf obo:MI_0019 . obo:MI_1018 obo:IAO_0000115 "A database of protein post translational modifications. www.abrf.org/index.cfm/dm.home" ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2010-11-11T11:04:13Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1018" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "deltamass" ; rdfs:subClassOf obo:MI_0447 . obo:MI_1019 obo:IAO_0000115 "Measures the catalysis of the reaction: a phosphoprotein + H2O = a protein + phosphate." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2010-11-11T11:30:47Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1019" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "protein phosphatase assay" ; rdfs:subClassOf obo:MI_0434 . obo:MI_1020 obo:IAO_0000115 "A carbonyl-reactive fluorescent labelling dye." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2010-11-11T11:35:48Z" ; oboInOwl:hasExactSynonym "hilyte 488" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1020" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "hilyte fluor 488" ; rdfs:subClassOf obo:MI_0857 . obo:MI_1021 obo:IAO_0000115 "Nonfluorescent dye, act as a quencher in FRET assays." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2010-11-11T11:40:16Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1021" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "qx 520" ; rdfs:subClassOf obo:MI_0373 . obo:MI_1022 obo:IAO_0000115 "A separation technique where a field is applied to a mixture perpendicular to the mixtures flow. The filed can be graviational, centrifugal, magnetic or a cross flow of fluids." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2010-11-11T11:55:40Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1022" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "field flow fractionation" ; rdfs:subClassOf obo:MI_0027 . obo:MI_1023 obo:IAO_0000115 "A nonfluorescent, biarsenical derivative of fluorescein. LumioGreen is supplied pre-complexed to EDT, is membrane-permeable, and readily enters the cell." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2010-11-11T12:10:26Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1023" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "luminogreen" ; rdfs:subClassOf obo:MI_0373 . obo:MI_1024 obo:IAO_0000115 "A type of electron microscope that images the sample surface by scanning it with a high-energy beam of electrons in a raster scan pattern. The electrons interact with the atoms that make up the sample producing signals that contain information about the sample's surface topography, composition and other properties such as electrical conductivity." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2010-11-11T12:17:54Z" ; oboInOwl:hasExactSynonym "sem" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1024" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "scanning electron microscopy" ; rdfs:subClassOf obo:MI_0040 . obo:MI_1025 obo:IAO_0000115 "A database of protein modifications for mass spectrometry. www.unimod.org" ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2010-11-11T12:24:10Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1025" ; a owl:Class ; rdfs:label "unimod" ; rdfs:subClassOf obo:MI_0447 . obo:MI_1026 obo:IAO_0000115 "Measurement of a modification that converts an L-histidine residue to diphthamide." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2010-11-11T12:33:29Z" ; oboInOwl:hasExactSynonym "diphtamidase" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1026" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "diphtamidase assay" ; rdfs:subClassOf obo:MI_0415 . obo:MI_1027 obo:IAO_0000115 "A modification that converts an L-histidine residue to diphthamide." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2010-11-11T12:36:51Z" ; oboInOwl:hasExactSynonym "diphthamidation" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1027" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "diphtamidation reaction" ; rdfs:subClassOf obo:MI_0414 . obo:MI_1028 obo:IAO_0000115 "Chromatin-bound protein networks isolated using magnetic beads coated with antibodies." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2010-11-11T12:58:52Z" ; oboInOwl:hasExactSynonym "mch-ip" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1028" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "modified chromatin immunoprecipitation" ; rdfs:subClassOf obo:MI_0402 . obo:MI_1029 obo:IAO_0000115 "Specific nucleic acid probes are fixed to solid supports (e.g. beads) and act as affinity probes. The molecules associated with the nucleic acid probes can then be isolated and identified." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2010-11-11T01:03:21Z" ; oboInOwl:hasExactSynonym "pich" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1029" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "proteomics of isolated chromatin segments" ; rdfs:subClassOf obo:MI_0402 . obo:MI_1030 obo:IAO_0000115 "Excimer (excited-dimer) fluorescence is produced by complexes formed by two molecules, at least one of which is in an excited state. It is characterized by a lower energy (i.e. red shift) than fluorescence of a single, non-interacting molecule." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2010-11-11T01:15:19Z" ; oboInOwl:hasExactSynonym "excimer fluoresc" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1030" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "excimer fluorescence" ; rdfs:subClassOf obo:MI_0051 . obo:MI_1031 obo:IAO_0000115 "A change in the rate of protein folding/unfolding is taken as a measure of chaperone protein binding." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2010-11-11T01:24:11Z" ; oboInOwl:hasExactSynonym "protein folding" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1031" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "protein folding/unfolding" ; rdfs:subClassOf obo:MI_0400 . obo:MI_1032 obo:IAO_0000115 "Fluorescent tag - maleimide couples to thiols." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2010-11-11T01:33:13Z" ; oboInOwl:hasExactSynonym "atto 488 maleimide" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:hasRelatedSynonym "atto488" ; oboInOwl:id "MI:1032" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "atto 488" ; rdfs:subClassOf obo:MI_1092 . obo:MI_1033 obo:IAO_0000115 "Fluorescent tag - maleimide couples to thiols." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2010-11-11T01:39:43Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:hasRelatedSynonym "atto550" ; oboInOwl:id "MI:1033" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "atto 550" ; rdfs:subClassOf obo:MI_1092 . obo:MI_1034 obo:IAO_0000115 "Measures the cleavage of phosphodiesterase bonds between the nucleotide subunits of nucleic acids." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2010-11-11T01:43:11Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1034" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "nuclease assay" ; rdfs:subClassOf obo:MI_0415 . obo:MI_1035 obo:IAO_0000115 "Measures the catalysis of the hydrolysis of phosphodiester bonds in chains of DNA." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2010-11-11T01:45:29Z" ; oboInOwl:hasExactSynonym "deoxyribonuclease" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1035" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "deoxyribonuclease assay" ; rdfs:subClassOf obo:MI_1034 . obo:MI_1036 obo:IAO_0000115 """Experiments monitoring interactions of nucleotide exchange factors with their cognate nucleotidases.""" ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2010-11-11T01:54:00Z" ; oboInOwl:hasExactSynonym "nucleotide exchange" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1036" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "nucleotide exchange assay" ; rdfs:subClassOf obo:MI_0401 . obo:MI_1037 obo:IAO_0000115 "The N-terminal portion of synthetic renilla luciferase (hrluc) is attached to one protein through the linker peptide (GGGS)2 and C-terminal portion of synthetic renilla luciferase is connected to the second protein through the linker (GGGGS)2. Interaction of the 2 proteins recovers hrluc activity and produces light." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2010-11-11T02:54:08Z" ; oboInOwl:hasExactSynonym "renilla luciferase" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1037" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "Split renilla luciferase complementation" ; rdfs:subClassOf obo:MI_1203 . obo:MI_1038 obo:IAO_0000115 "Measures selective electrical response to molecules binding to the immobilised bait." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2010-11-11T03:11:33Z" ; oboInOwl:hasExactSynonym "nanowire transistor" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1038" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "silicon nanowire field-effect transistor" ; rdfs:subClassOf obo:MI_0968 . obo:MI_1039 obo:IAO_0000115 "The C-terminal region of a sequence, exact coordinates not available." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2010-11-11T03:20:34Z" ; oboInOwl:hasExactSynonym "c-term range" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1039" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "c-terminal range" ; rdfs:subClassOf obo:MI_0333 . obo:MI_1040 obo:IAO_0000115 "The N-terminal region of a sequence, exact coordinates not available." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2010-11-11T03:27:57Z" ; oboInOwl:hasExactSynonym "n-term range" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1040" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "n-terminal range" ; rdfs:subClassOf obo:MI_0333 . obo:MI_1041 obo:IAO_0000115 "Alternative name or descriptor for an entity." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2010-12-02T10:26:35Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1041" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "synonym" ; rdfs:subClassOf obo:MI_0300 . obo:MI_1042 obo:IAO_0000115 "PubMed Central is the US National Institute of Health free digital archive of biomedical and life science journals." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2010-12-08T01:20:48Z" ; oboInOwl:hasDbXref "search-url:" ; oboInOwl:hasExactSynonym "pmc" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1042" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "pubmed central" ; rdfs:subClassOf obo:MI_0445 . obo:MI_1043 obo:IAO_0000115 "A repository for collecting, storing and and searching the annotation of gene or protein expression patterns in Drosophila melongaster. CPTI (Cambridge Protein Trap Identifier)" ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2011-01-06T01:16:48Z" ; oboInOwl:hasDbXref "id-validation-regexp:" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1043" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "flannotator" ; rdfs:subClassOf obo:MI_0683 . obo:MI_1044 obo:IAO_0000115 "NSF funded annotation project." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2011-02-11T01:33:28Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:hasRelatedSynonym "RGAP" ; oboInOwl:id "MI:1044" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "rice genome annotation project" ; rdfs:subClassOf obo:MI_1094 . obo:MI_1045 obo:IAO_0000115 "Indicates source, depth and standards by which an entry has been added to a database." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2011-03-11T01:16:55Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1045" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "curation content" ; rdfs:subClassOf obo:MI_0000 . obo:MI_1046 obo:IAO_0000115 "Defines an interaction by the type of binary molecule pairs it can generates." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2011-03-11T01:19:27Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1046" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "interacting molecules" ; rdfs:subClassOf obo:MI_1045 . obo:MI_1047 obo:IAO_0000115 "Interaction between a protein or peptide and a corresponding protein or peptide." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2011-03-11T01:21:28Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1047" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "protein-protein" ; rdfs:subClassOf obo:MI_1046 . obo:MI_1048 obo:IAO_0000115 "Interaction between a small molecule and a corresponding protein or peptide." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2011-03-11T01:22:36Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1048" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "smallmolecule-protein" ; rdfs:subClassOf obo:MI_1046 . obo:MI_1049 obo:IAO_0000115 "Interaction between a nucleic acid and a corresponding protein or peptide." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2011-03-11T01:23:29Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1049" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "nucleicacid-protein" ; rdfs:subClassOf obo:MI_1046 . obo:MI_1050 obo:IAO_0000115 "Provides an indication of the level of post-processing of experimental data relating to specific binary pairs" ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2011-03-11T01:25:29Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1050" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "interaction representation" ; rdfs:subClassOf obo:MI_1045 . obo:MI_1051 obo:IAO_0000115 "Binary pair is defined by a single piece of experimental evidence." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2011-03-11T01:27:00Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1051" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "evidence" ; rdfs:subClassOf obo:MI_1050 . obo:MI_1052 obo:IAO_0000115 "Binary pair is defined by multiple pieces of experimental evidence which have been clustered together." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2011-03-11T01:28:50Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1052" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "clustered" ; rdfs:subClassOf obo:MI_1050 . obo:MI_1053 obo:IAO_0000115 "The source of the data entered into the database." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2011-03-11T01:32:16Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1053" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "data source" ; rdfs:subClassOf obo:MI_1045 . obo:MI_1054 obo:IAO_0000115 "Data has been directly curated into the database from the paper describing the experimental evidence or by direct submission by the experimenter." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2011-03-11T01:33:48Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1054" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "experimentally-observed" ; rdfs:subClassOf obo:MI_1053 . obo:MI_1055 obo:IAO_0000115 "Data has been directly curated into this database from the paper describing the experimental evidence" ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2011-03-11T01:35:12Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1055" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "internally-curated" ; rdfs:subClassOf obo:MI_1053 . obo:MI_1056 obo:IAO_0000115 "The data has been entered into the database following extraction from the literature by a computational process." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2011-03-11T01:36:34Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1056" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "text-mining" ; rdfs:subClassOf obo:MI_1053 . obo:MI_1057 obo:IAO_0000115 "The interaction has been predicted using a specific algorithm." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2011-03-11T01:37:47Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1057" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "predicted" ; rdfs:subClassOf obo:MI_1053 . obo:MI_1058 obo:IAO_0000115 "The data has been imported into the database form an external resource." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2011-03-11T01:39:23Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1058" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "imported" ; rdfs:subClassOf obo:MI_1053 . obo:MI_1059 obo:IAO_0000115 "The method by which complex n-ary data is expanded into binary data. This may be performed manually on data input, or computationally on data export." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2011-03-11T01:41:16Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1059" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "complex expansion" ; rdfs:subClassOf obo:MI_1045 . obo:MI_1060 obo:IAO_0000115 "Complex n-ary data has been expanded to binary using the spoke model. This assumes that all molecules in the complex interact with a single designated molecule, usually the bait." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2011-03-11T01:42:35Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1060" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "spoke expansion" ; rdfs:subClassOf obo:MI_1059 . obo:MI_1061 obo:IAO_0000115 "Complex n-ary data has been expanded to binary using the spoke model. This assumes that all molecules in the complex interact with each other." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2011-03-11T01:45:52Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1061" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "matrix expansion" ; rdfs:subClassOf obo:MI_1059 . obo:MI_1062 obo:IAO_0000115 "Complex n-ary data has been expanded to binary using the bipartite model. This assumes that all molecules in the complex interact with a single externally designated entity." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2011-03-11T01:49:08Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1062" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "bipartite expansion" ; rdfs:subClassOf obo:MI_1059 . obo:MI_1063 obo:IAO_0000115 "ConsensusPathDB-human integrates functional interaction networks including complex protein-protein, metabolic, signaling and gene regulatory interaction networks in Homo sapiens. Data originate from currently 20 public resources for functional interactions (listed below), as well as interactions that we have curated from literature. Data are integrated in a complementary manner and redundancies are avoided." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2011-06-21T02:40:16Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1063" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "consensuspathdb" ; rdfs:subClassOf obo:MI_1106 . obo:MI_1064 obo:IAO_0000115 "A method used to derive a numerical or empirical measure of confidence in a particular interaction, or in the identification of the participants in an interaction." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2011-07-05T07:13:57Z" ; oboInOwl:hasExactSynonym "confidence", "scoring system" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1064" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "interaction confidence" ; rdfs:subClassOf obo:MI_0000 . obo:MI_1065 obo:IAO_0000115 "Methods based on counting the number of replicates in which an interaction has been observed." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2011-07-05T07:22:02Z" ; oboInOwl:hasExactSynonym "replication score" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:hasRelatedSynonym "replication-based scoring system" ; oboInOwl:id "MI:1065" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "replication-based confidence" ; rdfs:subClassOf obo:MI_1064 . obo:MI_1066 obo:IAO_0000115 "Confidence score based on similarity to interacting molecules of known structure, presence of known interacting domains etc." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2011-07-05T07:38:50Z" ; oboInOwl:hasExactSynonym "structure score", "structure-based scoring system" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1066" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "structure-based confidence" ; rdfs:subClassOf obo:MI_1064 . obo:MI_1067 obo:IAO_0000115 "Confidence in an interaction is based on shared functionality of interacting molecules e.g. co-occurrence of GO function terms." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2011-07-05T07:46:28Z" ; oboInOwl:hasExactSynonym "function score", "function-based scoring system" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1067" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "function-based confidence" ; rdfs:subClassOf obo:MI_1064, obo:MI_1221 . obo:MI_1068 obo:IAO_0000115 "Confidence in an interaction is based on shared functionality of interacting molecules e.g. co-occurrence of GO component terms or co-occurrence in the same tissues." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2011-07-05T07:52:36Z" ; oboInOwl:hasExactSynonym "colocation score", "location-based scoring system" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1068" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "location-based confidence" ; rdfs:subClassOf obo:MI_1064 . obo:MI_1069 obo:IAO_0000115 """Network-based confidence scoring systems assign confidence based on multiple parameters, potentially shared by interacting proteins e.g. interaction partners, topological parameters, comparison with genetic interactions.""" ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2011-07-05T07:59:13Z" ; oboInOwl:hasExactSynonym "network score", "network-based scoring system" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1069" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "network-based confidence" ; rdfs:subClassOf obo:MI_1064 . obo:MI_1070 obo:IAO_0000115 "Confidence scoring system based on comparison to a 'gold standard' set of known interacting molecules." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2011-07-05T08:09:46Z" ; oboInOwl:hasExactSynonym "standard score", "standard-based scoring system" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:hasRelatedSynonym "gold standard" ; oboInOwl:id "MI:1070" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "standard-based confidence" ; rdfs:subClassOf obo:MI_1064 . obo:MI_1071 obo:IAO_0000115 "Confidence in an interaction is based on co-occurrence of an interacting pair or molecules in the same article, or sentence within an article, usually identified by text-mining." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2011-07-05T08:24:46Z" ; oboInOwl:hasExactSynonym "literature score", "literature-based scoring system" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1071" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "literature-based confidence" ; rdfs:subClassOf obo:MI_1064 . obo:MI_1072 obo:IAO_0000115 "The confidence of an interaction is assessed on the number of different methods by which it is observed." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2011-07-05T08:42:47Z" ; oboInOwl:hasExactSynonym "method score", "method-based scoring system" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1072" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "method-based confidence" ; rdfs:subClassOf obo:MI_1064 . obo:MI_1073 obo:IAO_0000115 "Confidence in an interaction is based on a measure of the probability of these molecules interacting." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2011-07-05T08:50:05Z" ; oboInOwl:hasExactSynonym "statistical score", "statistical-based scoring system" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1073" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "statistical-based confidence" ; rdfs:subClassOf obo:MI_1064 . obo:MI_1074 obo:IAO_0000115 "The protein of interest is expressed as a fusion to a RGS(His)n tag." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2011-07-05T09:52:28Z" ; oboInOwl:hasExactSynonym "rgs-his" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1074" ; a owl:Class ; rdfs:label "rgs-his tag" ; rdfs:subClassOf obo:MI_0521 . obo:MI_1075 obo:IAO_0000115 "The Beilstein database is in the field of organic chemistry, in which compounds are uniquely identified by their Beilstein Registry Number." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2011-07-05T10:03:13Z" ; oboInOwl:hasExactSynonym "beilstein" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1075" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "beilstein" ; rdfs:subClassOf obo:MI_2054 . obo:MI_1076 obo:IAO_0000115 "The EINECS database provides general information such as CAS number, EINECS number, Substance Name and Chemical Formula for 100,204 chemical substances. Where available each compound entry is linked to risk and safety phrases and IUCLID and OECD chemical data sheets." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2011-07-05T10:09:35Z" ; oboInOwl:hasExactSynonym "European Inventory of Existing Commercial Chemical Substances ", "einecs" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1076" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "einecs" ; rdfs:subClassOf obo:MI_2054 . obo:MI_1077 obo:IAO_0000115 "Comprehensive information on chemicals, drugs, and biologicals." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2011-07-05T10:15:56Z" ; oboInOwl:hasExactSynonym "merck index" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1077" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "merck index" ; rdfs:subClassOf obo:MI_2054 . obo:MI_1078 obo:IAO_0000115 "PlantGDB develops plant species-specific EST and GSS databases, to provide web-accessible tools and inter-species query capabilities, and to provide genome browsing and annotation capabilities." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2011-07-05T10:27:50Z" ; oboInOwl:hasExactSynonym "plantgdb" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1078" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "plantgdb" ; rdfs:subClassOf obo:MI_1094 . obo:MI_1079 obo:IAO_0000115 "The rat genome database RatMap (http://ratmap.org or http://ratmap.gen.gu.se) has been one of the main resources for rat genome information since 1994. The database is maintained by CMB Genetics at Gothenburg University in Sweden and provides information on rat genes, polymorphic rat DNA-markers and rat quantitative trait loci (QTLs), all curated at RatMap." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2011-07-05T10:32:10Z" ; oboInOwl:hasExactSynonym "ratmap" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1079" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "ratmap" ; rdfs:subClassOf obo:MI_1094 . obo:MI_1080 obo:IAO_0000115 "The Arabidopsis Information Resource (TAIR) maintains a database of genetic and molecular biology data for the model higher plant Arabidopsis thaliana . Data available from TAIR includes the complete genome sequence along with gene structure, gene product information, metabolism, gene expression, DNA and seed stocks, genome maps, genetic and physical markers, publications, and information about the Arabidopsis research community." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2011-07-05T10:34:26Z" ; oboInOwl:hasExactSynonym "The Arabidopsis Information Resource", "tair" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1080" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "tair" ; rdfs:subClassOf obo:MI_1094 . obo:MI_1081 obo:IAO_0000115 "The J. Craig Venter Institute was formed in October 2006 through the merger of several affiliated and legacy organizations including The Institute for Genomic Research (TIGR)." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2011-07-05T10:44:11Z" ; oboInOwl:hasExactSynonym "J. Craig Venter Institute", "The Institute for Genomic Research", "tigr/jcvi" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1081" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "tigr/jcvi" ; rdfs:subClassOf obo:MI_1094 . obo:MI_1082 obo:IAO_0000115 "Extensive information on Danio rerio, including genomics databases, developmental stages, publications and molecular tools." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2011-07-05T10:53:21Z" ; oboInOwl:hasExactSynonym "The Zebrafish Model Organism Database ", "zfin" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1082" ; a owl:Class ; rdfs:label "zfin" ; rdfs:subClassOf obo:MI_1094 . obo:MI_1083 obo:IAO_0000115 "Clusters of Orthologous Groups of proteins (COGs) were delineated by comparing protein sequences encoded in complete genomes, representing major phylogenetic lineages. Each COG consists of individual proteins or groups of paralogs from at least 3 lineages and thus corresponds to an ancient conserved domain." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2011-07-05T10:59:06Z" ; oboInOwl:hasExactSynonym "Clusters of Orthologous Groups", "cogg" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1083" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "cog" ; rdfs:subClassOf obo:MI_0447 . obo:MI_1084 obo:IAO_0000115 "Any molecule that is able to transfer a photon to another chemical species." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2011-07-05T11:03:38Z" ; oboInOwl:hasExactSynonym "photon donor" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1084" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "photon donor" ; rdfs:subClassOf obo:MI_0918 . obo:MI_1085 obo:IAO_0000115 "Molecule to which a photon may be transferred from an photon donor." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2011-07-05T11:06:47Z" ; oboInOwl:hasExactSynonym "photon acceptor" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1085" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "photon acceptor" ; rdfs:subClassOf obo:MI_0919 . obo:MI_1086 obo:IAO_0000115 "Two chambers are separated by a dialysis membrane. The molecular weight cut off (MWCO) of this membrane is chosen such that it will retain the receptor component of the sample (the element which will bind the ligand). A known concentration and volume of ligand is placed into one of the chambers. The ligand is small enough to pass freely through the membrane. A known concentration of receptor is then placed in the remaining chamber in an equivalent volume to that placed in the first chamber. As the ligand diffuses across the membrane some of it will bind to the receptor and some will remain free in solution. The higher the affinity of the interaction, the higher the concentration of ligand that will be bound at any time." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2011-07-05T11:12:25Z" ; oboInOwl:hasExactSynonym "equilib. dialysis" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1086" ; a owl:Class ; rdfs:label "equilibrium dialysis" ; rdfs:subClassOf obo:MI_0013 . obo:MI_1087 obo:IAO_0000115 "Method to block a binding site on a molecule, such as a protein, using a monoclonal antibody to test that the binding site is involved in an interaction with another molecule." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2011-07-05T11:19:37Z" ; oboInOwl:hasExactSynonym "mab blockade" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1087" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "monoclonal antibody blockade" ; rdfs:subClassOf obo:MI_0400, obo:MI_2197 . obo:MI_1088 obo:IAO_0000115 "Assays that are used to determine interactions by monitoring, for example activation of a certain pathway when screening for inhibitors of a given receptor." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2011-07-05T11:24:37Z" ; oboInOwl:hasExactSynonym "phenotype-based" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1088" ; a owl:Class ; rdfs:label "phenotype-based detection assay" ; rdfs:subClassOf obo:MI_0045 . obo:MI_1089 obo:IAO_0000115 "Method to detect interaction by inducing nuclear localization of one participant, which would then pull an interacting participant along with it into the nucleus. As both participants are labeled, the difference in nuclear localization between the induced and non-induced states provides an indication of the interaction between the two molecules." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2011-07-05T11:27:16Z" ; oboInOwl:hasExactSynonym "nuclear translocation" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1089" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "nuclear translocation assay" ; rdfs:subClassOf obo:MI_1088 . obo:MI_1090 obo:IAO_0000115 "Bromobimanes are low molecular weight non-fluorescent alkyl halides which react with thiol groups to produce highly fluorescent derivatives. The bimane labels, monobromobimane, dibromobimane, and monobromotrimethylammoniobimane, are derivatives of syn-9,10-dioxabimane:1,5-diazabicyclo[3.3.0]octa-3,6-diene-2,8-dione." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2011-07-05T12:03:52Z" ; oboInOwl:hasExactSynonym "bimane" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1090" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "bimane label" ; rdfs:subClassOf obo:MI_0857 . obo:MI_1091 obo:IAO_0000115 "Title of the publication." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2011-07-05T12:07:49Z" ; oboInOwl:hasExactSynonym "title" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1091" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "publication title" ; rdfs:subClassOf obo:MI_1093 . obo:MI_1092 obo:IAO_0000115 "Fluorescent dyes - spectral range 500 to 700 nm." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2011-07-05T12:14:52Z" ; oboInOwl:hasExactSynonym "atto label" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1092" ; a owl:Class ; rdfs:label "atto label" ; rdfs:subClassOf obo:MI_0857 . obo:MI_1093 obo:IAO_0000115 "Attributes specific to the publication." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2011-07-05T12:55:21Z" ; oboInOwl:hasExactSynonym "bib attribute", "publication attribute" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1093" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "bibliographic attribute name" ; rdfs:subClassOf obo:MI_0665 . obo:MI_1094 obo:IAO_0000115 "Databases which are the responsible for the maintenance and subsequent annotation of one or more genomic sequences." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2011-07-06T07:57:46Z" ; oboInOwl:hasExactSynonym "genome databases" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1094" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "genome databases" ; rdfs:subClassOf obo:MI_0683 . obo:MI_1095 obo:IAO_0000115 "HGNC is the nomenclature committee responsible for the naming of human genes." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2011-07-06T08:02:03Z" ; oboInOwl:hasExactSynonym "Human Genome Nomenclature Committee", "hgnc" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1095" ; a owl:Class ; rdfs:label "hgnc" ; rdfs:subClassOf obo:MI_1109 . obo:MI_1096 obo:IAO_0000115 "Databases dedicated to the collection and annotation of protein sequences." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2011-07-06T08:10:40Z" ; oboInOwl:hasExactSynonym "protein seq db" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1096" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "protein sequence databases" ; rdfs:subClassOf obo:MI_0683 . obo:MI_1097 obo:IAO_0000115 "UniProt is a centralized repository of protein sequences with comprehensive coverage and a systematic approach to protein annotation, incorporating, interpreting, integrating and standardizing data from numerous sources and is the most comprehensive catalog of protein sequences and functional annotation." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2011-07-06T08:14:40Z" ; oboInOwl:hasExactSynonym "uniprot" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1097" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "uniprot" ; rdfs:subClassOf obo:MI_1096 . obo:MI_1098 obo:IAO_0000115 """UniProt (Universal Protein Resource) is the world's most comprehensive catalogue of information on proteins. It is a central repository of protein sequence and function created by joining the information contained in Swiss-Prot, TrEMBL, and PIR. UniProtKB/Swiss-Prot is manually curated which means that the information in each entry is annotated and reviewed by a curator. http://www.uniprot.org""" ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2011-07-06T08:17:34Z" ; oboInOwl:hasDbXref "id-validation-regexp:", "search-url:" ; oboInOwl:hasExactSynonym "UniProt", "swiss-prot" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1098" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "uniprot/swiss-prot" ; rdfs:subClassOf obo:MI_0486 . obo:MI_1099 obo:IAO_0000115 """UniProt (Universal Protein Resource) is the world's most comprehensive catalogue of information on proteins. It is a central repository of protein sequence and function created by joining the information contained in Swiss-Prot, TrEMBL, and PIR. The records in UniProtKB/TrEMBL are automatically generated and are enriched with automatic annotation and classification. http://www.uniprot.org""" ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2011-07-06T08:20:24Z" ; oboInOwl:hasDbXref "id-validation-regexp:", "search-url:" ; oboInOwl:hasExactSynonym "UniProt", "trembl" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1099" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "uniprot/trembl" ; rdfs:subClassOf obo:MI_0486 . obo:MI_1100 obo:IAO_0000115 "Molecules showing activity in a living system but not encoded by a genomic sequence." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2011-07-06T08:23:48Z" ; oboInOwl:hasExactSynonym "bioactive entity" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1100" ; a owl:Class ; rdfs:label "bioactive entity" ; rdfs:subClassOf obo:MI_0313 . obo:MI_1101 obo:IAO_0000115 "The Standard InChIKey has five distinct components, a 14-character hash of the basic (Mobile-H) InChI layer, an 8-character hash of the remaining layers (except for the /p segment, which accounts for added or removed protons: it is not hashed at all; the number of protons is encoded at the end of the standard InChIKey.) , a 1 flag character, a 1 version character and the last character is a [de]protonation indicator. The overall length of InChIKey is fixed at 27 characters, including separators (dashes)." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2014-01-21T10:14:02Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1101" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "standard inchi key" ; rdfs:subClassOf obo:MI_0970 . obo:MI_1102 obo:IAO_0000115 "Sequence has been computationally remapped following removal or update of the original sequence in the underlying sequence database." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2011-07-06T09:07:02Z" ; oboInOwl:hasExactSynonym "mapped-identity" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1102" ; a owl:Class ; rdfs:label "mapped-identity" ; rdfs:subClassOf obo:MI_0353 . obo:MI_1103 obo:IAO_0000115 """NMR solution state analysis provides useful data regarding the type, quantity and arrangement of different atoms in chemical systems, liquids and solids. Samples are dissolved in deuterated solvents and spectra consist of a series of very sharp transitions, due to averaging of anisotropic NMR interactions by rapid random tumbling. Solution-state NMR only requires that the molecule be soluble at sufficient concentration for data collection, but becomes increasingly difficult for biomolecules over 30 kDa so that a practical size limitation is placed on full structure determinations.""" ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2011-07-06T09:16:45Z" ; oboInOwl:hasExactSynonym "solution nmr", "solution state nmr" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1103" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "solution state nmr" ; rdfs:subClassOf obo:MI_0077 . obo:MI_1104 obo:IAO_0000115 """Solid-state NMR (ssNMR) does not require that the sample be soluble or form a crystal, and the approach can be used to study molecules larger than 100 kD. Solid-state NMR spectra are very broad, as the full effects of anisotropic or orientation-dependent interactions are observed in the spectrum.""" ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2011-07-06T09:23:11Z" ; oboInOwl:hasExactSynonym "solid state nmr", "ssnmr" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1104" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "solid state nmr" ; rdfs:subClassOf obo:MI_0077 . obo:MI_1105 obo:IAO_0000115 "BioCyc is a collection of Pathway/Genome Databases. Each database in the BioCyc collection describes the genome and metabolic pathways of a single organism. (http://biocyc.org/)." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2011-07-06T09:43:03Z" ; oboInOwl:hasExactSynonym "biocyc" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1105" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "biocyc" ; rdfs:subClassOf obo:MI_1106 . obo:MI_1106 obo:IAO_0000115 "Databases which primarily exist to display biomolecular information in structured pathways. Interactions data can be inferred from the published pathways." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2011-07-07T02:52:18Z" ; oboInOwl:hasExactSynonym "pathways db" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1106" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "pathways database" ; rdfs:subClassOf obo:MI_0461 . obo:MI_1107 obo:IAO_0000115 "Curated collection of information about known biomolecular interactions and key cellular processes assembled into signaling pathways. It is a collaborative project between the US National Cancer Institute (NCI) and Nature Publishing Group (NPG), and is an open access online resource (http://pid.nci.nih.gov/)." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2011-07-07T03:00:27Z" ; oboInOwl:hasExactSynonym "pathways interaction database", "pid" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1107" ; a owl:Class ; rdfs:label "pid" ; rdfs:subClassOf obo:MI_1106 . obo:MI_1108 obo:IAO_0000115 "BioCarta, whose core business is in assays and reagents, has also developed a collection of diagrams representing molecular and cellular signal transduction pathways." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2011-07-07T03:05:55Z" ; oboInOwl:hasExactSynonym "biocarta" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1108" ; a owl:Class ; rdfs:label "biocarta" ; rdfs:subClassOf obo:MI_1106 . obo:MI_1109 obo:IAO_0000115 "Primarily nomenclature/cross-reference databases, used by curators to establish a link between a gene and protein ID. In some cases, database records do not contain actual sequence but point to loci on specific reference genomes." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2011-07-08T08:00:33Z" ; oboInOwl:hasExactSynonym "gene dbs" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1109" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "gene database" ; rdfs:subClassOf obo:MI_0473 . obo:MI_1110 obo:IAO_0000115 "Interaction has been predicted by either interologue mapping, by an algorithm or by a computational method." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2011-08-03T11:14:11Z" ; oboInOwl:hasExactSynonym "predicted" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1110" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "predicted interaction" ; rdfs:subClassOf obo:MI_0190 . obo:MI_1111 obo:IAO_0000115 "Individual baits are mated against pools of preys, or pools of baits are mated against individual preys. This approach required cloning baits and preys into both two-hybrid vectors, followed by pooling sets of transformants. The positive double hybrid clones are the interacting partners." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2011-09-29T03:19:21Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1111" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "two hybrid bait or prey pooling approach" ; rdfs:subClassOf obo:MI_0398 . obo:MI_1112 obo:IAO_0000115 "Individual baits are mated against pools of preys. This approach required cloning baits and preys into both two-hybrid vectors, followed by pooling sets of transformants. The positive double hybrid clones are the interacting partners." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2011-09-29T03:21:01Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1112" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "two hybrid prey pooling approach" ; rdfs:subClassOf obo:MI_1111 . obo:MI_1113 obo:IAO_0000115 "def" ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2011-09-29T03:23:17Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1113" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "two hybrid bait and prey pooling approach" ; rdfs:subClassOf obo:MI_0398 . obo:MI_1114 obo:IAO_0000115 "A database of viral-host interactions." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2011-10-19T01:28:24Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1114" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "virhostnet" ; rdfs:subClassOf obo:MI_0461 . obo:MI_1115 obo:IAO_0000115 "SPIKE" ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2011-11-09T10:27:04Z" ; oboInOwl:hasExactSynonym "Signalling Pathways Integrated Knowledge Engine" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1115" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "spike" ; rdfs:subClassOf obo:MI_1106 . obo:MI_1116 obo:IAO_0000115 "GeneMANIA predicts interactions based on multiple evidences including physical and genetic interactions, pathways, co-localisation, co-expression and protein domain similarity." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2011-11-09T02:13:28Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1116" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "genemania" ; rdfs:subClassOf obo:MI_0461 . obo:MI_1117 obo:IAO_0000115 "TopFIND provides information on protein N- and C-termini. Information of proteases and their substrates is provided." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2011-11-16T11:09:25Z" ; oboInOwl:hasExactSynonym "Termini-oriented protein function inferred database" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1117" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "topfind" ; rdfs:subClassOf obo:MI_0461 . obo:MI_1118 obo:IAO_0000115 "A variation of yellow fluorescent protein derived from eGFP." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2011-11-24T03:17:33Z" ; oboInOwl:hasExactSynonym "eyfp" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1118" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "enhanced yellow fluorescent protein tag" ; rdfs:subClassOf obo:MI_0368 . obo:MI_1119 obo:IAO_0000115 "n-terminal fragment of yellow fluorescent protein used as a tag in bimolecular fluorescence complementation (BiFC)." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2011-11-24T03:30:18Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:hasRelatedSynonym "N-terminal part of YFP" ; oboInOwl:id "MI:1119" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "nYFP" ; rdfs:subClassOf obo:MI_0368, obo:MI_1215 . obo:MI_1120 obo:IAO_0000115 "c-terminal fragment of yellow fluorescent protein used as a tag in bimolecular fluorescence complementation (BiFC)." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2011-11-24T03:43:07Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:hasRelatedSynonym "C-terminal part of YFP" ; oboInOwl:id "MI:1120" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "cYFP" ; rdfs:subClassOf obo:MI_0368, obo:MI_1215 . obo:MI_1121 obo:IAO_0000115 "c-terminal fragment of enhanced yellow fluorescent protein used as a tag in bimolecular fluorescence complementation (BiFC)." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2011-11-24T03:43:30Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:hasRelatedSynonym "C-terminal part of EYFP" ; oboInOwl:id "MI:1121" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "ceYFP" ; rdfs:subClassOf obo:MI_1118 . obo:MI_1122 obo:IAO_0000115 "n-terminal fragment of enhanced yellow fluorescent protein used as a tag in bimolecular fluorescence complementation (BiFC)." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2011-11-24T03:44:40Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:hasRelatedSynonym "N-terminal part of EYFP" ; oboInOwl:id "MI:1122" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "neYFP" ; rdfs:subClassOf obo:MI_1118 . obo:MI_1123 obo:IAO_0000115 "BindingDB is a web-accessible public database of experimentally determined protein-ligand binding affinities for drug discovery. http://BindingDB.org" ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2011-11-28T08:55:26Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1123" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "bindingdb" ; rdfs:subClassOf obo:MI_0461 . obo:MI_1124 obo:IAO_0000115 """Allows the user to browse and search pathways across multiple public pathway databases. http://www.pathwaycommons.org""" ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2011-11-30T03:04:14Z" ; oboInOwl:hasExactSynonym "Pathway Commons" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1124" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "pathwaycommons" ; rdfs:subClassOf obo:MI_1106 . obo:MI_1125 obo:IAO_0000115 "The defined region of protein which makes physical contact with the interacting partner." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-01-03T01:10:25Z" ; oboInOwl:hasExactSynonym "direct binding" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1125" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:comment "Should normally be used with X-ray crystallography or NMR data." ; rdfs:label "direct binding region" ; rdfs:subClassOf obo:MI_0442 . obo:MI_1126 obo:IAO_0000115 "Intra-molecular interaction between two or more regions of the same molecule." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-01-03T01:19:22Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1126" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:comment "The corresponding experimental role will be self/putative self. Not to be used for autocatalysis, when the additional biological role self/putative self will supply this information." ; rdfs:label "self interaction" ; rdfs:subClassOf obo:MI_0407 . obo:MI_1127 obo:IAO_0000115 "Interaction between two or more regions of possibly the same molecule but it is also possible that the observation is due to an interaction between two identical molecules." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-01-03T01:21:58Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1127" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:comment "The corresponding experimental role should be self/putative self. Not to be used for autocatalysis, when the additional biological role self/putative self will supply this information." ; rdfs:label "putative self interaction" ; rdfs:subClassOf obo:MI_0407 . obo:MI_1128 obo:IAO_0000115 "Region of a molecule whose mutation or deletion totally disrupts an interaction strength." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-01-03T01:36:37Z" ; oboInOwl:hasExactSynonym "mutation disrupting strength" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1128" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "mutation disrupting interaction strength" ; rdfs:subClassOf obo:MI_0573 . obo:MI_1129 obo:IAO_0000115 "Region of a molecule whose mutation or deletion totally disrupts an interaction rate (in the case of interactions inferred from enzymatic reaction).." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-01-03T01:37:43Z" ; oboInOwl:hasExactSynonym "mutation disrupting rate" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1129" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "mutation disrupting interaction rate" ; rdfs:subClassOf obo:MI_0573 . obo:MI_1130 obo:IAO_0000115 "Region of a molecule whose mutation or deletion decreases significantly interaction rate (in the case of interactions inferred from enzymatic reaction)." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-01-03T01:38:58Z" ; oboInOwl:hasExactSynonym "mutation decreasing rate" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1130" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "mutation decreasing interaction rate" ; rdfs:subClassOf obo:MI_0119 . obo:MI_1131 obo:IAO_0000115 "Region of a molecule whose mutation or deletion increases significantly interaction rate (in the case of interactions inferred from enzymatic reaction)." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-01-03T01:45:09Z" ; oboInOwl:hasExactSynonym "mutation increasing rate" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1131" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "mutation increasing interaction rate" ; rdfs:subClassOf obo:MI_0382 . obo:MI_1132 obo:IAO_0000115 "Region of a molecule whose mutation or deletion increases significantly interaction strength." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-01-03T01:45:42Z" ; oboInOwl:hasExactSynonym "mutation increasing strength" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1132" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "mutation increasing interaction strength" ; rdfs:subClassOf obo:MI_0382 . obo:MI_1133 obo:IAO_0000115 "Region of a molecule whose mutation or deletion decreases significantly interaction strength." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-01-03T01:48:40Z" ; oboInOwl:hasExactSynonym "mutation decreasing strength" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1133" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "mutation decreasing interaction strength" ; rdfs:subClassOf obo:MI_0119 . obo:MI_1134 obo:IAO_0000115 "mCherry is a red monomer which matures extremely rapidly, making it possible to see results very soon after activating transcription. It is highly photostable and resistant to photobleaching. Excitation maximum: 587 nm. Emission maximum: 610 nm." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-01-03T02:53:23Z" ; oboInOwl:hasExactSynonym "mcherry" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1134" ; a owl:Class ; rdfs:label "mcherry fluorescent protein tag" ; rdfs:subClassOf obo:MI_0732 . obo:MI_1135 obo:IAO_0000115 "Introduction of a point mutation into Aequorea-derived YFP, the substitution of leucine for phenylalanine at position 46 (F46L), produced Venus. This mutation dramatically accelerates oxidation of the chromophore, the rate-limiting step in fluorescent protein maturation. Additional mutations were also introduced in order to increase the tolerance of Venus to acidic environments and to reduce the sensitivity to chloride. The absorption and emission spectral peaks are 515 and 528 nanometers, respectively." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-01-03T03:05:01Z" ; oboInOwl:hasExactSynonym "venus" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1135" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "venus fluorescent protein tag" ; rdfs:subClassOf obo:MI_0368 . obo:MI_1136 obo:IAO_0000115 "Monomeric coral fluorescent reporter protein." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-01-03T03:10:28Z" ; oboInOwl:hasExactSynonym "kusabira-green" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1136" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "kusabira-green protein tag" ; rdfs:subClassOf obo:MI_0367 . obo:MI_1137 obo:IAO_0000115 "The measurement of a the introduction of a carboxylic acid group into a substrate." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-01-03T03:17:56Z" ; oboInOwl:hasExactSynonym "carboxylation assay" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1137" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "carboxylation assay" ; rdfs:subClassOf obo:MI_0415 . obo:MI_1138 obo:IAO_0000115 "The measurement of a the introduction of a carboxylic acid group into a substrate." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-01-03T03:22:04Z" ; oboInOwl:hasExactSynonym "decarboxxylation assay" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1138" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "decarboxylation assay" ; rdfs:subClassOf obo:MI_0415 . obo:MI_1139 obo:IAO_0000115 "Carboxylation is a posttranslational modification of glutamate residues, to gamma-carboxyglutamate, in proteins." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-01-03T03:24:05Z" ; oboInOwl:hasExactSynonym "carboxylation" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1139" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "carboxylation reaction" ; rdfs:subClassOf obo:MI_0414 . obo:MI_1140 obo:IAO_0000115 "Decarboxylation is a chemical reaction that releases carbon dioxide (CO2). Usually, decarboxylation refers to a reaction of carboxylic acids, removing a carbon atom from a carbon chain. Enzymes that catalyze decarboxylations are called decarboxylases or, the more formal term, carboxy-lyases (EC number 4.1.1)." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-01-03T03:31:42Z" ; oboInOwl:hasExactSynonym "decarboxylation" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1140" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "decarboxylation reaction" ; rdfs:subClassOf obo:MI_0414 . obo:MI_1141 obo:IAO_0000115 "S-tag is the name of an oligopeptide derived from pancreatic ribonuclease A (RNase A). The amino acid sequence of the S-tag is: Lys-Glu-Thr-Ala-Ala-Ala-Lys-Phe-Glu-Arg-Gln-His-Met-Asp-Ser." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-01-03T03:37:51Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1141" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "s tag" ; rdfs:subClassOf obo:MI_0507 . obo:MI_1142 obo:IAO_0000115 "The measurement of the addition of an aminoacyl group to a compound." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-01-03T03:46:46Z" ; oboInOwl:hasExactSynonym "aminoacylation" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1142" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "aminoacylation assay" ; rdfs:subClassOf obo:MI_0415 . obo:MI_1143 obo:IAO_0000115 "Aminoacylation is the process of adding an aminoacyl group to a compound." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-01-03T03:49:50Z" ; oboInOwl:hasExactSynonym "aminoacylation" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1143" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "aminoacylation reaction" ; rdfs:subClassOf obo:MI_0414 . obo:MI_1144 obo:IAO_0000115 "Protein A tag is visualized by interacting with IgG antibodies (or their derivatives) that are specifically recognized by protein A." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-01-03T03:54:35Z" ; oboInOwl:hasExactSynonym "protein a visualisation" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1144" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "protein a tag visualisation" ; rdfs:subClassOf obo:MI_0866 . obo:MI_1145 obo:IAO_0000115 "A phospholipase is an enzyme that hydrolyzes phospholipids into fatty acids and other lipophilic substances. There are four major classes, termed A, B, C and D, distinguished by the type of reaction which they catalyze." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-01-03T04:04:16Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1145" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "phospholipase assay" ; rdfs:subClassOf obo:MI_0415 . obo:MI_1146 obo:IAO_0000115 "Measurement of the hydrolysis of phospholipids into fatty acids and other lipophilic substances. There are four major classes, termed A, B, C and D, distinguished by the type of reaction which they catalyze." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-01-03T04:08:14Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1146" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "phospholipase reaction" ; rdfs:subClassOf obo:MI_0414 . obo:MI_1147 obo:IAO_0000115 """Measurement of AMPylation, the formation of a phosphodiester or phosphoramide ester of AMP on Tyr (RESID:AA0203), Lys (RESID:AA0227), Thr (RESID:AA0267), His (RESID:AA0371) and other amino acids.""" ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-01-03T04:18:27Z" ; oboInOwl:hasExactSynonym "ampylation assay" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1147" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "ampylation assay" ; rdfs:subClassOf obo:MI_0415 . obo:MI_1148 obo:IAO_0000115 """AMPylation, previously known as adenylylation, is formation of a phosphodiester or phosphoramide ester of AMP on Tyr (RESID:AA0203), Lys (RESID:AA0227), Thr (RESID:AA0267), His (RESID:AA0371) and other amino acids.""" ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-01-03T04:21:12Z" ; oboInOwl:hasExactSynonym "ampylation" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1148" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "ampylation reaction" ; rdfs:subClassOf obo:MI_0414 . obo:MI_1149 obo:IAO_0000115 "A set of molecular binding events that influence each other either positively or negatively through allostery or pre-assembly. In this context, covalent post-translational modifications are considered as binding events. CV terms that are part of this term allow the description of cooperative interactions using the current PSI-MI schema." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-06-07T12:21:30Z" ; oboInOwl:hasExactSynonym "cooperativity" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1149" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "cooperative interaction" ; rdfs:subClassOf obo:MI_0000 . obo:MI_1150 obo:IAO_0000115 "For an interaction that has a cooperative effect on a subsequent interaction, this term indicates which subsequent interaction is affected. The affected interaction is identified by referring to its interaction id." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-06-07T12:26:42Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1150" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "affected interaction" ; rdfs:subClassOf obo:MI_0664, obo:MI_1149 . obo:MI_1151 obo:IAO_0000115 "Referring to a previously described interaction as a participant allows the description of ordered assembly of molecular complexes in PSI-MI2.5. When one of the components of the preformed complex has a feature, the participant-ref term indicates on which component this feature is located. The component is identified by referring to its participant id in the previous interaction." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-06-07T12:30:48Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1151" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "participant-ref" ; rdfs:subClassOf obo:MI_0668 . obo:MI_1152 obo:IAO_0000115 "This value quantifies the cooperative effect of an interaction on a subsequent interaction. It is the fold change of the affinity or a catalytic parameter of a molecule for one ligand in the absence, versus presence, of a second ligand or a post-translational modification." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-06-07T12:35:01Z" ; oboInOwl:hasExactSynonym "cooperative coupling" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1152" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "cooperative effect value" ; rdfs:subClassOf obo:MI_0664, obo:MI_1149 . obo:MI_1153 obo:IAO_0000115 "For an interaction that has a cooperative effect on a subsequent interaction, this term indicates whether this effect is positive or negative, i.e. whether the subsequent interaction is augmented or diminished." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-06-07T12:40:41Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1153" ; a owl:Class ; rdfs:label "cooperative effect outcome" ; rdfs:subClassOf obo:MI_1149 . obo:MI_1154 obo:IAO_0000115 "This term specifies that an interaction augments a subsequent interaction." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-06-07T12:42:19Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1154" ; a owl:Class ; rdfs:label "positive cooperative effect" ; rdfs:subClassOf obo:MI_0664, obo:MI_1153 . obo:MI_1155 obo:IAO_0000115 "This term specifies that an interaction diminishes a subsequent interaction." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-06-07T12:43:48Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1155" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "negative cooperative effect" ; rdfs:subClassOf obo:MI_0664, obo:MI_1153 . obo:MI_1156 obo:IAO_0000115 "For an interaction that has a cooperative effect on a subsequent interaction, this term indicates the process that mediates this effect." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-06-07T12:46:30Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1156" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "cooperative mechanism" ; rdfs:subClassOf obo:MI_1149 . obo:MI_1157 obo:IAO_0000115 "Reciprocal energetic coupling between two binding events at distinct sites on the same molecule. The first binding event alters the binding or catalytic properties of the molecule for the second binding event." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-06-07T12:50:20Z" ; oboInOwl:hasExactSynonym "allosteric regulation" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1157" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "allostery" ; rdfs:subClassOf obo:MI_0664, obo:MI_1156 . obo:MI_1158 obo:IAO_0000115 "A non-allosteric mechanism where the strength of an interaction depends on whether or not a particular molecular complex already exists." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-06-07T12:52:44Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1158" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "pre-assembly" ; rdfs:subClassOf obo:MI_0664, obo:MI_1156 . obo:MI_1159 obo:IAO_0000115 "A molecule whose binding or catalytic properties at one site are altered by allosteric post-translational modification or binding of an allosteric effector at a distinct site. An allosteric molecule is identified by referring to its participant id." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-06-07T12:55:09Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1159" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "allosteric molecule" ; rdfs:subClassOf obo:MI_0500, obo:MI_0664, obo:MI_1149 . obo:MI_1160 obo:IAO_0000115 "A ligand that elicits an allosteric response upon binding to a target molecule." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-06-07T12:57:50Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1160" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "allosteric effector" ; rdfs:subClassOf obo:MI_0500, obo:MI_0664, obo:MI_1149 . obo:MI_1161 obo:IAO_0000115 "This term describes the effect of an allosteric binding event. It specifies which properties of the allosteric molecule are altered, i.e. whether the interaction alters either (a) binding or (b) catalytic properties of the allosteric molecule at a site distinct from the allosteric site." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-06-07T01:05:17Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1161" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "allosteric response" ; rdfs:subClassOf obo:MI_1149 . obo:MI_1162 obo:IAO_0000115 "An allosteric response in which the affinity of a molecule is altered." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-06-07T01:08:01Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1162" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "allosteric k-type response" ; rdfs:subClassOf obo:MI_0664, obo:MI_1161 . obo:MI_1163 obo:IAO_0000115 "An allosteric response in which catalysis (kcat or Vmax) of an enzyme is altered." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-06-07T01:09:07Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1163" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "allosteric v-type response" ; rdfs:subClassOf obo:MI_0664, obo:MI_1161 . obo:MI_1164 obo:IAO_0000115 "The process that mediates the allosteric response of a molecule upon allosteric post-translational modification or binding of an allosteric effector." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-06-07T01:10:45Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1164" ; a owl:Class ; rdfs:label "allosteric mechanism" ; rdfs:subClassOf obo:MI_1149 . obo:MI_1165 obo:IAO_0000115 "The allosteric mechanism where changes in the local structure of an allosteric molecule result in altered binding or catalytic properties." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-06-07T01:16:20Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1165" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "allosteric change in structure" ; rdfs:subClassOf obo:MI_0664, obo:MI_1164 . obo:MI_1166 obo:IAO_0000115 "The allosteric mechanism where changes in the local dynamics of an allosteric molecule result in altered binding or catalytic properties." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-06-07T01:17:54Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1166" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "allosteric change in dynamics" ; rdfs:subClassOf obo:MI_0664, obo:MI_1164 . obo:MI_1167 obo:IAO_0000115 "This term indicates the chemical relationship between the two ligands whose binding is allosterically coupled." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-06-07T01:19:57Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1167" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "allostery type" ; rdfs:subClassOf obo:MI_1149 . obo:MI_1168 obo:IAO_0000115 "The type of allostery that occurs when the two ligands whose binding is allosterically coupled are not chemically identical." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-06-07T01:21:25Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1168" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "heterotropic allostery" ; rdfs:subClassOf obo:MI_0664, obo:MI_1167 . obo:MI_1169 obo:IAO_0000115 "The type of allostery that occurs when the two ligands whose binding is allosterically coupled are chemically identical." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-06-07T01:22:35Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1169" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "homotropic allostery" ; rdfs:subClassOf obo:MI_0664, obo:MI_1167 . obo:MI_1170 obo:IAO_0000115 "This term describes the way in which preformation of a molecular complex has a non-allosteric cooperative effect on subsequent interactions of its components." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-06-07T01:24:42Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1170" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "pre-assembly response" ; rdfs:subClassOf obo:MI_1149 . obo:MI_1171 obo:IAO_0000115 "The preformation of a complex results in the generation of a continuous binding site that spans more than one component of this complex. The functional binding site does not exist outside the context of the preformed complex." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-06-07T01:25:50Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1171" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "composite binding site formation" ; rdfs:subClassOf obo:MI_0664, obo:MI_1170 . obo:MI_1172 obo:IAO_0000115 "The addition of a PTM to an interaction interface affects the physicochemical compatibility of the binding site with its binding partner. This can either induce or enhance an interaction, or result in inhibition or even abrogation of an interaction. Multisite modification can mediate rheostatic regulation of the interaction." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-06-07T01:26:56Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1172" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "altered physicochemical compatibility" ; rdfs:subClassOf obo:MI_0664, obo:MI_1170 . obo:MI_1173 obo:IAO_0000115 "The occurrence of overlapping or adjacent, mutually exclusive binding sites promotes competitive binding. When there is a large difference in affinity of the different sites or in local abundance of competitors, binding at one site results in hiding of the second site, thereby precluding it from interacting when the hiding molecule is present." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-06-07T01:28:07Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1173" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "binding site hiding" ; rdfs:subClassOf obo:MI_0664, obo:MI_1170 . obo:MI_1174 obo:IAO_0000115 "Multivalent ligands form multiple discrete interactions with one or more binding partners. In some cases, An initial binding event can pre-organize other sites for binding. This reduces the degrees of freedom of these sites, thus reducing the entropic costs of their interactions. In addition, the combined strength of multiple interactions increases the enthalpic stability of each interaction (avidity effect). As a result of such effects, interactions of this kind can have a cooperative effect on subsequent interactions." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-06-07T01:29:13Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1174" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "configurational pre-organization" ; rdfs:subClassOf obo:MI_0664, obo:MI_1170 . obo:MI_1175 obo:IAO_0000115 "A post-translational modification that elicits an allosteric response upon addition to a target molecule. An allosteric post-translational modification is identified by referring to its feature id." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-06-07T01:33:16Z" ; oboInOwl:hasExactSynonym "allosteric ptm" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1175" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "allosteric post-translational modification" ; rdfs:subClassOf obo:MI_0252, obo:MI_0664, obo:MI_1149 . obo:MI_1176 obo:IAO_0000115 "Sequence analysis of the regulatory region of a gene used to predict specific elements, transcription factor binding sites (TFBS), where binding of specific transcription factors can occur." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-06-07T01:40:25Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:hasRelatedSynonym "gene regulatory region prediction", "sequence based prediction of TG regulatory region binding sites for TF " ; oboInOwl:id "MI:1176" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "sequence based prediction of gene regulatory region binding sites" ; rdfs:subClassOf obo:MI_0101 . obo:MI_1177 obo:IAO_0000115 "Sequence analysis based on multiple homologous alignments of the regulatory region of a gene used to predict specific elements, transcription factor binding sites (TFBS), where binding of specific transcription factors can occur. These methods often also use transcription factor binding motif models." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-06-07T01:41:59Z" ; oboInOwl:hasExactSynonym "gene regulatory region phylogeny" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:hasRelatedSynonym "phylogenetic footprinting" ; oboInOwl:id "MI:1177" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "phylogenetic profiling of predicted gene regulatory region binding sites" ; rdfs:subClassOf obo:MI_0100, obo:MI_1176 . obo:MI_1178 obo:IAO_0000115 "Computational methods based on evolutionary hypothesis, used as criteria to browse sequences and predict a transcription factor using structural and sequence features of the protein, e.g., by evaluating if the potential transcription factor protein contains a DNA-binding domain that is known to bind to some regulatory elements, or prediction of transcription factor functional domains (DNA binding, transcription factor dimerization, etc.), all based on sequence or structural features of the transcription factor." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-06-07T01:43:57Z" ; oboInOwl:hasExactSynonym "sequence based prediction of binding of TF to TG promoter", "transcription factor prediction" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1178" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "sequence based prediction of binding of transcription factor to transcribed gene regulatory elements" ; rdfs:subClassOf obo:MI_0101 . obo:MI_1179 obo:IAO_0000115 "Identification of a part of a nucleotide sequence, usually then related to the full length sequence by alignment. Depending on the experimental design, nucleotide sequence can be determined before the interaction detection while building a collection of clones or after the selection of randomly generated clone.s" ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-06-07T01:47:03Z" ; oboInOwl:hasExactSynonym "partial nucleotide sequence" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1179" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "partial nucleotide sequence identification" ; rdfs:subClassOf obo:MI_0078 . obo:MI_1180 obo:IAO_0000115 "Identification of a part of a DNA sequence, usually then related to the full length sequence by alignment. Depending on the experimental design, nucleotide sequence can be determined before the interaction detection while building a collection of clones or after the selection of randomly generated clones." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-06-07T01:52:27Z" ; oboInOwl:hasExactSynonym "partial dna sequence" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1180" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "partial DNA sequence identification" ; rdfs:subClassOf obo:MI_1179 . obo:MI_1181 obo:IAO_0000115 "Paired-end tags (PET) are the short sequences at the 5 prime and 3 prime ends of the DNA fragment of interest, which can be a piece of genomic DNA or cDNA." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-06-07T01:53:38Z" ; oboInOwl:hasExactSynonym "paired end tags" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1181" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "paired end tags sequence identification" ; rdfs:subClassOf obo:MI_1180 . obo:MI_1182 obo:IAO_0000115 "Sequencing occurs during the course of the experiment. To sequence RNA, the usual method is first to reverse transcribe the sample to generate cDNA fragments." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-06-07T02:02:37Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1182" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "full identification by RNA sequencing" ; rdfs:subClassOf obo:MI_0078 . obo:MI_1183 obo:IAO_0000115 "Binding of a molecule to a strand of nucleic acid protects that region of nucleic acid from the action of a nuclease. The protected region can subsequently be sequenced and the binding site identified." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-06-07T02:08:36Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:hasRelatedSynonym "nuclease protection" ; oboInOwl:id "MI:1183" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "nuclease footprinting" ; rdfs:subClassOf obo:MI_0605 . obo:MI_1184 obo:IAO_0000115 "DNA adenine methyltransferase identification is used to map the binding sites of DNA- and chromatin-binding proteins in eukaryotes. DamID identifies binding sites by expressing the proposed DNA-binding protein as a fusion protein with DNA methyltransferase. Binding of the protein of interest to DNA localizes the methyltransferase in the region of the binding site. Adenosine methylation does not occur naturally in eukaryotes and therefore adenine methylation in any region can be concluded to have been caused by the fusion protein, implying the region is located near a binding site." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-06-07T02:13:03Z" ; oboInOwl:hasExactSynonym "DamID" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1184" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "dna adenine methyltransferase identification" ; rdfs:subClassOf obo:MI_1313 . obo:MI_1185 obo:IAO_0000115 "Proteins of interest are tagged with Escherichia coli DNA adenine methyltransferase (dam). Expression of this fusion protein in vivo leads to preferential methylation of adenines in DNA surrounding the native binding sites of the dam fusion partner. Because adenine methylation does not occur endogenously in most eukaryotes, it provides a unique tag to mark protein interaction sites. The adenine-methylated DNA fragments are isolated by selective polymerase chain reaction amplification and can be identified by microarray hybridization." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-06-07T02:22:19Z" ; oboInOwl:hasExactSynonym "tag DNA methyltransferase" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1185" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "tag visualisation by dna adenine methyltransferase" ; rdfs:subClassOf obo:MI_0980 . obo:MI_1186 obo:IAO_0000115 "The protein of interest is fused to Escherichia coli DNA adenine methyltransferase (dam). Expression of this fusion protein in vivo leads to preferential methylation of adenines in DNA surrounding the native binding sites of the dam fusion partner. Because adenine methylation does not occur endogenously in most eukaryotes, it provides a unique tag to mark protein interaction sites." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-06-07T02:32:02Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1186" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "dna methyltransferase tag" ; rdfs:subClassOf obo:MI_0365 . obo:MI_1187 obo:IAO_0000115 "A mutant form of DNA adenine methyltransferase (DamK9A) from E. coli is fused to the protein of interest and expressed. The fusion protein will bind to target binding sites and introduce N-6-adenine methylation in nearby sites in the genomic DNA. Methylated DNA fragments are enriched with an antibody against N-6-methyladenine and used for further analysis." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-06-07T02:41:40Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1187" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "damip" ; rdfs:subClassOf obo:MI_1184 . obo:MI_1188 obo:IAO_0000115 "A mutant form of DNA adenine methyltransferase (DamK9A) from E. coli is fused to the protein of interest and expressed. The fusion protein will bind to target binding sites and introduce N-6-adenine methylation in nearby sites in the genomic DNA." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-06-07T02:46:08Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1188" ; a owl:Class ; rdfs:label "tag visualisation by mutated dna adenine methyltransferase" ; rdfs:subClassOf obo:MI_1185 . obo:MI_1189 obo:IAO_0000115 "In interference assays, the DNA will be methylated before the binding assay. Protein binding to DNA protects DNA from methylation by dimethylsulphate. If the contact points are methylated, the protein binding is prevented. After isolating the protein-DNA complex, the methylation sites are cleaved by chemical method. As a result, only those regions out of the binding sites will be cleaved. The protein binding region is not methylated; hence, this region is not cleaved. Although the pattern looks like a footprint, the blank region means \"contact points\"." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-06-07T02:54:00Z" ; oboInOwl:hasExactSynonym "methylation interference" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:hasRelatedSynonym "contact point analysis", "methylation protection assay" ; oboInOwl:id "MI:1189" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "methylation interference assay" ; rdfs:subClassOf obo:MI_0605 . obo:MI_1190 obo:IAO_0000115 "Hydroxyl radicals are created from the Fenton reaction, which involves reducing Fe2+ with H2O2 to form free hydroxyl molecules. These hydroxyl molecules react with the DNA backbone, resulting in a break. Protein bound regions of the DNA are protected." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-06-07T03:10:48Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1190" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "hydroxy radical footprinting" ; rdfs:subClassOf obo:MI_0602 . obo:MI_1191 obo:IAO_0000115 "Ultraviolet irradiation excites nucleic acids and creates photoreactions, which results in damaged bases in the DNA strand. Protein bound regions of the DNA are protected. UV footprinting technique can detect sequence-specific protein-DNA interactions in vivo. Protein contacts can inhibit of enhance UV photoproduct formation by affecting the ability of DNA to adopt a geometry necessary for the formation of a UV photoproduct. Thus, differences in the strand-breakage patterns of protein-free and protein-bound DNA can be used to detect protein-DNA contacts." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-06-07T03:13:02Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1191" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "ultraviolet (uv) footprinting" ; rdfs:subClassOf obo:MI_0417 . obo:MI_1192 obo:IAO_0000115 "This approach is based on the observation that a synthesized nucleic acid that is complementary to a specific mRNA can decrease the synthesis of its gene product either by increasing the degradation of the targeted mRNA or by interfering with its translation." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-06-07T03:19:22Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1192" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "antisense oligonucleotides" ; rdfs:subClassOf obo:MI_0255 . obo:MI_1193 obo:IAO_0000115 "Identification of a part of a RNA sequence, usually then related to the full length sequence by alignment." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-06-07T03:40:14Z" ; oboInOwl:hasExactSynonym "partial rna sequence" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1193" ; a owl:Class ; rdfs:label "partial RNA sequence identification" ; rdfs:subClassOf obo:MI_1179 . obo:MI_1194 obo:IAO_0000115 "Reverse Transcription PCR (RT-PCR) is used for amplifying DNA from RNA. Reverse transcriptase reverse transcribes RNA into cDNA, which is then amplified by PCR." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-06-07T03:47:13Z" ; oboInOwl:hasExactSynonym "RT-PCR" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:hasRelatedSynonym "RPCR", "reverse PCR" ; oboInOwl:id "MI:1194" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "reverse transcription pcr" ; rdfs:subClassOf obo:MI_0088 . obo:MI_1195 obo:IAO_0000115 "Quantitative PCR (Q-PCR) is used to measure the quantity of a PCR product (commonly in real-time). It quantitatively measures starting amounts of DNA, cDNA, or RNA." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-06-07T03:56:38Z" ; oboInOwl:hasExactSynonym "q-pcr" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:hasRelatedSynonym "QRT-PCR", "RQ-PCR", "RTQ-PCR" ; oboInOwl:id "MI:1195" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "quantitative pcr" ; rdfs:subClassOf obo:MI_0088 . obo:MI_1196 obo:IAO_0000115 "Technique used to measure the quantity of DNA amplified from RNA." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-06-07T04:04:42Z" ; oboInOwl:hasExactSynonym "QRT-PCR" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:hasRelatedSynonym "RTQ-PCR" ; oboInOwl:id "MI:1196" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "quantitative reverse transcription pcr" ; rdfs:subClassOf obo:MI_1194 . obo:MI_1197 obo:IAO_0000115 "To perform a radioimmunoassay, a known quantity of an antigen is made radioactive, frequently by labeling it with gamma-radioactive isotopes of iodine attached to tyrosine. This radiolabeled antigen is then mixed with a known amount of antibody for that antigen, and as a result, the two chemically bind to one another. Then, a sample containing an unknown quantity of that same antigen is added. This causes the unlabeled (or \"cold\") antigen from the serum to compete with the radiolabeled antigen (\"hot\") for antibody binding sites. As the concentration of \"cold\" antigen is increased, more of it binds to the antibody, displacing the radiolabeled variant, and reducing the ratio of antibody-bound radiolabeled antigen to free radiolabeled antigen. The bound antigens are then separated from the unbound ones, and the radioactivity of the free antigen remaining in the supernatant is measured." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-06-07T04:13:30Z" ; oboInOwl:hasExactSynonym "RIA" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1197" ; a owl:Class ; rdfs:label "radioimmunoassay" ; rdfs:subClassOf obo:MI_0421 . obo:MI_1198 obo:IAO_0000115 "Method using an antibody coupled with some colouring agent to detect a specific protein within a tissue sample. In some cases the primary antibody is directly linked to a colouring agent, more often the primary antibody is targeted by a secondary antibody, targeting the primary antibody." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-06-07T04:17:12Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1198" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "immunohistochemistry" ; rdfs:subClassOf obo:MI_0422 . obo:MI_1199 obo:IAO_0000115 "Method using an antibody coupled with some colouring agent to detect a tag fused to a specific protein within a tissue sample. In some cases the primary antibody is directly linked to a colouring agent, more often the primary antibody is targeted by a secondary antibody, targeting the primary antibody." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-06-07T04:21:23Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1199" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "anti-tag immunohistochemistry" ; rdfs:subClassOf obo:MI_1198 . obo:MI_1200 obo:IAO_0000115 "Method using an antibody coupled with some colouring agent to detect a specific protein within a cell. In some cases the primary antibody is directly linked to a colouring agent, more often the primary antibody is targeted by a secondary antibody, targeting the primary antibody." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-06-07T04:22:00Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1200" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "immunocytochemistry" ; rdfs:subClassOf obo:MI_0422 . obo:MI_1201 obo:IAO_0000115 "Method using an antibody coupled with some colouring agent to detect a specific tag fused to a protein within a cell. In some cases the primary antibody is directly linked to a colouring agent, more often the primary antibody is targeted by a secondary antibody, targeting the primary antibody." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-06-07T04:33:37Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1201" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "anti-tag immunocytochemistry" ; rdfs:subClassOf obo:MI_1200 . obo:MI_1202 obo:IAO_0000115 "Synthetic peptide tag (SAWSHPQFEK-(GGGS)2-SAWSHPQFEK)" ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-06-07T04:44:55Z" ; oboInOwl:hasExactSynonym "twin-strep-tag" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1202" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "one-strep-tag" ; rdfs:subClassOf obo:MI_0507 . obo:MI_1203 obo:IAO_0000115 "Two proteins of interest, a bait and prey, which are genetically fused to amino- and carboxy-terminal fragments of luciferase, are transiently expressed. Physical interactions of these bait and prey proteins reconstitute some of the luciferase activity and result in light emission in the presence of the luciferase substrate." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-06-07T04:56:59Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1203" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "split luciferase complementation" ; rdfs:subClassOf obo:MI_0090 . obo:MI_1204 obo:IAO_0000115 "Two proteins of interest, a bait and prey, which are genetically fused to amino- and carboxy-terminal fragments of firefly (Photinus pyralis) luciferase, are transiently expressed. Physical interactions of these bait and prey proteins reconstitute some of the luciferase activity and result in light emission in the presence of the luciferase substrate." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-06-07T05:05:36Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1204" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "split firefly luciferase complementation" ; rdfs:subClassOf obo:MI_1203 . obo:MI_1205 obo:IAO_0000115 "Luciferase is a generic term for the class of oxidative enzymes used in bioluminescence and is distinct from a photoprotein. Luciferase catalyzes a bioluminescent reaction which requires the substrate luciferin as well as Mg2+ and ATP, produces green light with a wavelength of 562 nm." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-06-07T05:20:20Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1205" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "luciferase tag" ; rdfs:subClassOf obo:MI_0240 . obo:MI_1206 obo:IAO_0000115 "The n-terminus of the renilla luciferase protein, fused to a protein of interest for use in the split luciferase complementation assay." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-06-07T05:26:34Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:hasRelatedSynonym "N-terminal fragment of renilla luciferase" ; oboInOwl:id "MI:1206" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "renilla-n" ; rdfs:subClassOf obo:MI_0896, obo:MI_1215 . obo:MI_1207 obo:IAO_0000115 "The c-terminus of the renilla luciferase protein, fused to a protein of interest for use in the split luciferase complementation assay." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-06-07T05:31:32Z" ; oboInOwl:hasExactSynonym "C-terminal fragment of renilla luciferase" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1207" ; a owl:Class ; rdfs:label "renilla-c" ; rdfs:subClassOf obo:MI_0896, obo:MI_1215 . obo:MI_1208 obo:IAO_0000115 "Firefly luciferase, is an enzyme from beetles (Photinus pyralis) catalyzing the oxidation of the lucifering pigment (reaction with ATP or oxygen) that produces light. Firefly luciferase produces a greenish yellow light in the 550-570nm range." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-06-07T05:32:53Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1208" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "firefly luciferase protein tag" ; rdfs:subClassOf obo:MI_1205 . obo:MI_1209 obo:IAO_0000115 "The c-terminus of the firefly luciferase protein, fused to a protein of interest for use in the split luciferase complementation assay." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-06-07T05:40:04Z" ; oboInOwl:hasExactSynonym "C-terminal fragment of firefly luciferase" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1209" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "firefly-c" ; rdfs:subClassOf obo:MI_1208, obo:MI_1215 . obo:MI_1210 obo:IAO_0000115 "The n-terminus of the firefly luciferase protein, fused to a protein of interest for use in the split luciferase complementation assay." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-06-07T05:41:30Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:hasRelatedSynonym "N-terminal fragment of firefly luciferase" ; oboInOwl:id "MI:1210" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "firefly-n" ; rdfs:subClassOf obo:MI_1208, obo:MI_1215 . obo:MI_1211 obo:IAO_0000115 "Lipid binding proteins incubated with liposomes of known lipid content. Mixture is then centrifuged and proteins bound to liposomes separated out." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-06-07T05:51:15Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:hasRelatedSynonym "liposome centrifugation assay" ; oboInOwl:id "MI:1211" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "liposome binding assay" ; rdfs:subClassOf obo:MI_0027 . obo:MI_1212 obo:IAO_0000115 "A fixed-size datum calculated (by using a hash function) for a molecular sequence or structure, typically for purposes of error detection or indexing." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-06-07T05:54:41Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:hasRelatedSynonym "hashsum" ; oboInOwl:id "MI:1212" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "checksum" ; rdfs:subClassOf obo:MI_0666 . obo:MI_1213 obo:IAO_0000115 "N-terminal region of the Venus fusion protein, created by the introduction of a point mutation into Aequorea-derived YFP, the substitution of leucine for phenylalanine at position 46 (F46L). This tag is used for split flurescence complementation assays." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-06-07T06:33:51Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1213" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "n-venus" ; rdfs:subClassOf obo:MI_1135, obo:MI_1215 . obo:MI_1214 obo:IAO_0000115 "C-terminal region of the Venus fusion protein, created by the introduction of a point mutation into Aequorea-derived YFP, the substitution of leucine for phenylalanine at position 46 (F46L). This tag is used for split flurescence complementation assays." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-06-07T06:39:30Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1214" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "c-venus" ; rdfs:subClassOf obo:MI_1135, obo:MI_1215 . obo:MI_1215 obo:IAO_0000115 "Fusion protein which consists of either the N- or C-terminal sequence of a fluorescent or luciferase protein. Binding of the proteins of interest enable the reassembly of the molecule, indicating that an interaction has occured." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-06-07T07:13:53Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1215" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "bifc tag" ; rdfs:subClassOf obo:MI_0240 . obo:MI_1216 obo:IAO_0000115 "c-terminal fragment of green fluorescent protein used as a tag in bimolecular fluorescence complementation (BiFC)." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-06-07T07:19:55Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1216" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "cGFP" ; rdfs:subClassOf obo:MI_0367, obo:MI_1215 . obo:MI_1217 obo:IAO_0000115 "n-terminal fragment of green fluorescent protein used as a tag in bimolecular fluorescence complementation (BiFC)." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-06-07T07:20:57Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1217" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "nGFP" ; rdfs:subClassOf obo:MI_0367, obo:MI_1215 . obo:MI_1218 obo:IAO_0000115 "Chromosome conformation capture,[1] or 3C, is a high-throughput molecular biology technique used to analyze the organization of chromosomes in a cell's natural state. The basic 3C technique consists of cross-linking by addition of formaldehyde followed by addition of a restriction enzyme in excess to the cross-linked DNA, separating the non-cross-linked DNA from the cross-linked chromatin. A intramolecular ligation step using very low concentrations of DNA favors the ligation of relevant DNA fragments with the corresponding junctions instead of the ligation of random fragments. There are two major types of ligation junctions that are over-represented. One is the junction that forms between neighboring DNA fragments due to incomplete digestion, which represents about 20-30% of all junctions. This number is decreased by reducing the cross-linking stringency in the first step. The other type of junctions over-represented in this technique is the junction that forms when one end of the fragment ligates with the other end of the same fragment, and contributes up to 30% of all junctions formed. High temperature then results in the reversal of the previously formed cross-links. The resulting linear DNA fragment has specific restriction ends as well as a central restriction site corresponding to the site of ligation. The pool of these fragments is collectively referred to as the 3C library." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-06-07T07:25:28Z" ; oboInOwl:hasExactSynonym "chip-3c" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1218" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "chromosome conformation capture assay" ; rdfs:subClassOf obo:MI_0030 . obo:MI_1219 obo:IAO_0000115 "Enzyme-mediated activation of radical sources is used to identify partners of a given molecule on the cell surface in living cells Activation of the cross-linking reagent arylazide-biotin tag is accomplished by an enzyme, horseradish peroxidase is featured by radical formation of the labelling reagent by horseradish peroxidase (HRP)." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-06-07T07:34:30Z" ; oboInOwl:hasExactSynonym "emars" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1219" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "enzyme-mediated activation of radical sources" ; rdfs:subClassOf obo:MI_0013 . obo:MI_1220 obo:IAO_0000115 "The protein is expressed as a hybrid protein fused to a tag containing a luciferase activity. Subsequence observation or measurement of luciferase activity is used to identify the presence of the molecule in an interaction." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-06-11T11:52:57Z" ; oboInOwl:hasExactSynonym "tag luciferase" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1220" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "tag visualisation by luciferase assay" ; rdfs:subClassOf obo:MI_0980 . obo:MI_1221 obo:IAO_0000115 "A score generated by an author, usually only relevant for that particular dataset." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-06-11T11:54:23Z" ; oboInOwl:hasExactSynonym "author score" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1221" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "author-based confidence" ; rdfs:subClassOf obo:MI_1064 . obo:MI_1222 obo:IAO_0000115 "MBInfo is a wiki based, multimedia, educational resource providing up to date reviews on topics relating to mechanobiology (http://www.mechanobio.info/)." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-06-11T12:20:53Z" ; oboInOwl:hasExactSynonym "MBInfo" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1222" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "mbinfo" ; rdfs:subClassOf obo:MI_0461, obo:MI_0973 . obo:MI_1223 obo:IAO_0000115 "Post translational modification on a protein observed to decrease the strength or rate of an interaction." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-06-11T12:56:47Z" ; oboInOwl:hasExactSynonym "decreasing-ptm" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1223" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "ptm decreasing an interaction" ; rdfs:subClassOf obo:MI_0925 . obo:MI_1224 obo:IAO_0000115 "Post translational modification on a protein observed to increase the strength or rate of an interaction." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-06-11T12:58:43Z" ; oboInOwl:hasExactSynonym "increasing-ptm" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1224" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "ptm increasing an interaction" ; rdfs:subClassOf obo:MI_0925 . obo:MI_1225 obo:IAO_0000115 "Post translational modification on a protein observed to disrupt the strength or rate of an interaction." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-06-11T12:59:28Z" ; oboInOwl:hasExactSynonym "disrupting-ptm" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1225" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "ptm disrupting an interaction" ; rdfs:subClassOf obo:MI_0925 . obo:MI_1226 obo:IAO_0000115 "Formation of phosphodiester or phosphoramide ester of AMP on Tyr (RESID:AA0203), Lys (RESID:AA0227), Thr (RESID:AA0267), His (RESID:AA0371) and other amino acids" ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-06-11T01:06:07Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:hasRelatedSynonym "ampylation" ; oboInOwl:id "MI:1226" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "ampylation assay" ; owl:deprecated true . obo:MI_1227 obo:IAO_0000115 "Tag encoding green fluorescent protein (GFP) , a TEV cleavage site, and a second purification tag such as S peptide or 6xHis. The tag can therefore be used for both localisation and affinity purification." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-06-11T01:16:05Z" ; oboInOwl:hasExactSynonym "lap tag" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:hasRelatedSynonym "location and purification tag" ; oboInOwl:id "MI:1227" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "lap tag" ; rdfs:subClassOf obo:MI_0677 . obo:MI_1228 obo:IAO_0000115 "A polyoma virus-derived (Pyo) epitope tag (amino acids MEYMPME)." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-08-10T07:28:55Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1228" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "pyo tag" ; rdfs:subClassOf obo:MI_0507 . obo:MI_1229 obo:IAO_0000115 "Measures the formation of a phosphodiester or phosphoramide ester of UMP and an amino acid (MOD:01166)." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-08-10T07:46:07Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1229" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "uridylation assay" ; rdfs:subClassOf obo:MI_0415 . obo:MI_1230 obo:IAO_0000115 "The formation of a phosphodiester or phosphoramide ester of UMP and amino acid (MOD:01166)." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-08-10T07:50:08Z" ; oboInOwl:hasExactSynonym "uridylation" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:hasRelatedSynonym "umpylation" ; oboInOwl:id "MI:1230" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "uridylation reaction" ; rdfs:subClassOf obo:MI_0414 . obo:MI_1231 obo:IAO_0000115 "AMC (aminomethylcoumarin ) is a blue fluorescent tag with reactive derivatives that are used as contrasting probes for double- and triple-labeling in immunofluorescence microscopy, arrays and in situ hybridization and can be attached to proteins or small molecules for reaction monitoring." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-08-10T07:59:18Z" ; oboInOwl:hasExactSynonym "AMC label" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1231" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "aminomethylcoumarin label" ; rdfs:subClassOf obo:MI_1328 . obo:MI_1232 obo:IAO_0000115 "An interaction between two proteins is inferred from monitoring the effect of the presence of one of them on the aggregation state of the second." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-08-10T08:07:15Z" ; oboInOwl:hasExactSynonym "aggregation" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1232" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "aggregation assay" ; rdfs:subClassOf obo:MI_0401 . obo:MI_1233 obo:IAO_0000115 "The cleavage which results due to the action of a proteolytic enzyme on its substrate." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-08-10T08:14:45Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1233" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:comment "Any feature range given should span the cleavage region e.g. 102-103 if the peptide bond between residues 102 and 103 is cut." ; rdfs:label "resulting-cleavage" ; rdfs:subClassOf obo:MI_0639 . obo:MI_1234 obo:IAO_0000115 "SILAC (Stable Isotope Labeling by Amino acids in Cell culture) can be used to detect features (typically PTMs) required for a given interaction." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-08-10T08:45:50Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1234" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "silac" ; rdfs:subClassOf obo:MI_0659 . obo:MI_1235 obo:IAO_0000115 "Ligand binding to a target protein can stabilize a protein's native state, as shown in the increase of the bound protein's melting temperature. The midpoint of the melting curve of a protein will increase in the presence of ligands that bind more tightly to the native state than the unfolded state." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-08-10T08:52:14Z" ; oboInOwl:hasExactSynonym "thermal shift" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:hasRelatedSynonym "thermshift binding assay" ; oboInOwl:id "MI:1235" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "thermal shift binding" ; rdfs:subClassOf obo:MI_0013 . obo:MI_1236 obo:IAO_0000115 "Measurment of the conversion between cis- and trans- peptide bonds formed by the amine group of a proline. Peptide bonds to proline, and to other N-substituted amino acids (such as sarcosine), are able to populate both the cis and trans isomers the cis and trans isomers of the X-Pro peptide bond (where X represents any amino acid) both experience steric clashes with the neighboring substitution and are nearly equal energetically. Hence, the fraction of X-Pro peptide bonds in the cis isomer under unstrained conditions ranges from 10-40%; the fraction depends slightly on the preceding amino acid, with aromatic residues favoring the cis isomer slightly." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-08-10T08:56:38Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1236" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "proline isomerase assay" ; rdfs:subClassOf obo:MI_1249 . obo:MI_1237 obo:IAO_0000115 "The conversion between cis- and trans- peptide bonds formed by the amine group of a proline." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-08-10T09:02:28Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1237" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "proline isomerization reaction" ; rdfs:subClassOf obo:MI_1250 . obo:MI_1238 obo:IAO_0000115 "Heavy/light isotope-labelled subunits are prepared and allowed to form their respective mature oligomeric structure. Oligomers are then mixed and subunit exchange is monitored, usually by electrospray ionisation-ion mobility spectrometry-mass spectrometry." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-08-10T09:11:36Z" ; oboInOwl:hasExactSynonym "ms subunit exchange" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1238" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "mass spectrometry studies of subunit exchange" ; rdfs:subClassOf obo:MI_0069 . obo:MI_1239 obo:IAO_0000115 "A naturally-occuring amino-acid variation to the reference sequence, including polymorphisms, variations between strains, isolates or cultivars, disease-associated mutations and RNA editing events." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-08-10T09:20:55Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:hasRelatedSynonym "SAP", "single amino-acid polymorphism" ; oboInOwl:id "MI:1239" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "amino-acid variant" ; rdfs:subClassOf obo:MI_1241 . obo:MI_1240 obo:IAO_0000115 "A naturally-occuring amino-acid variation to the reference sequence which results in the organism developing, or becoming susceptible to a particular disease condition." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-08-10T09:28:06Z" ; oboInOwl:hasExactSynonym "disease aa variant" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:hasRelatedSynonym "disease sap", "disease single amino acid polymorphism" ; oboInOwl:id "MI:1240" ; a owl:Class ; rdfs:label "disease causing amino-acid variant" ; rdfs:subClassOf obo:MI_1239 . obo:MI_1241 obo:IAO_0000115 "A natural change in a sequence or structure in comparison to a reference entity." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-08-10T09:32:29Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1241" ; a owl:Class ; rdfs:label "variant" ; rdfs:subClassOf obo:MI_0252 . obo:MI_1242 obo:IAO_0000115 "A fusion protein tag consisting of a portion of the constant region of IgG1." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-08-10T10:10:25Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1242" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "fc-igg1" ; rdfs:subClassOf obo:MI_0975 . obo:MI_1243 obo:IAO_0000115 "A fusion protein tag consisting of a portion of the constant region of IgG2." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-08-10T10:14:13Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1243" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "fc-igg2" ; rdfs:subClassOf obo:MI_0975 . obo:MI_1244 obo:IAO_0000115 "Monomeric far-red fluorescent protein generated from the wild-type RFP from sea anemone Entacmaea quadricolor. It possesses bright fluorescence with excitation/emission maxima at 588 and 635 nm, respectively." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-08-10T11:22:13Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1244" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "mkate2" ; rdfs:subClassOf obo:MI_0732 . obo:MI_1245 obo:IAO_0000115 "Monomeric far-red fluorescent protein generated from the wild-type RFP from sea anemone Entacmaea quadricolor. It possesses bright fluorescence with excitation/emission maxima at 588 and 635 nm, respectively." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-08-10T11:48:12Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:hasRelatedSynonym "TagFP635" ; oboInOwl:id "MI:1245" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "mkate" ; rdfs:subClassOf obo:MI_0732 . obo:MI_1246 obo:IAO_0000115 "IM-MS analysis is performed by first ionizing the protein complex of interest followed by ion mobility separation according to their cross-section-to-charge (Q/z) ratio. After separation, ions are sampled by a mass spectrometer and analyzed according to their mass-to-charge (m/z) ratio. Combined knowledge of both Q/z and m/z can be used to infer the size and shape of the complex." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-08-10T11:56:05Z" ; oboInOwl:hasExactSynonym "ion mobility mass spec" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:hasRelatedSynonym "iM-MS" ; oboInOwl:id "MI:1246" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "ion mobility mass spectrometry of complexes" ; rdfs:subClassOf obo:MI_0069 . obo:MI_1247 obo:IAO_0000115 "Measurement of the directed movement of particles in a microscopic temperature gradient. Any change of the hydration shell of biomolecules due to changes in their structure/conformation results in a relative change of movement along the temperature gradient and is used to determine binding affinities, binding kinetics and activity kinetics. Events such as the phosphorylation of a protein or the binding of small molecules to a target can be monitored." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-08-10T12:20:37Z" ; oboInOwl:hasExactSynonym "mst" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1247" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "microscale thermophoresis" ; rdfs:subClassOf obo:MI_0013 . obo:MI_1248 obo:IAO_0000115 "Composed of dipyrromethene complexed with a disubstituted boron atom, typically a BF2 unit. Notable for their uniquely small Stokes shift, high, environment-independent fluorescence quantum yields." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-08-10T12:34:54Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:hasRelatedSynonym "4,4-difluoro-4-bora-3a,4a-diaza-s-indacene", "boron-dipyrromethene label" ; oboInOwl:id "MI:1248" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "bodipy label" ; rdfs:subClassOf obo:MI_0857 . obo:MI_1249 obo:IAO_0000115 "Measurement of the catalysis of the structural rearrangement of isomers." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-08-10T12:45:27Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1249" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "isomerase assay" ; rdfs:subClassOf obo:MI_0415 . obo:MI_1250 obo:IAO_0000115 "The catalysis of the structural rearrangement of isomers." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-08-10T12:51:00Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1250" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "isomerase reaction" ; rdfs:subClassOf obo:MI_0414 . obo:MI_1251 obo:IAO_0000115 "The catalysis of the conversion of methylmalonyl-CoA to succinyl-CoA by transfer of the carbonyl group. It requires a cobamide coenzyme. EC 5.4.99.2." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-08-10T01:23:35Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1251" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "methylmalonyl-CoA isomerase reaction" ; rdfs:subClassOf obo:MI_1250 . obo:MI_1252 obo:IAO_0000115 "The catalysis othe conversion of methylmalonyl-CoA to succinyl-CoA by transfer of the carbonyl group. It requires a cobamide coenzyme. EC 5.4.99.2" ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-08-10T01:29:23Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1252" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "methylmalonyl-CoA isomerase asf say" ; rdfs:subClassOf obo:MI_1249 . obo:MI_1253 obo:IAO_0000115 "Fluorescent tag - maleimide couples to thiols." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-08-10T01:49:01Z" ; oboInOwl:hasExactSynonym "atto 532 maleimide" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:hasRelatedSynonym "atto532" ; oboInOwl:id "MI:1253" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "atto 532" ; rdfs:subClassOf obo:MI_1092 . obo:MI_1254 obo:IAO_0000115 "Fluorescent tag - maleimide couples to thiols." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-08-10T01:51:00Z" ; oboInOwl:hasExactSynonym "atto 647 maleimide" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:hasRelatedSynonym "atto647" ; oboInOwl:id "MI:1254" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "atto 647" ; rdfs:subClassOf obo:MI_1092 . obo:MI_1255 obo:IAO_0000115 "1,2-Diphenylethene" ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-08-10T01:56:28Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1255" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "stilbene label" ; rdfs:subClassOf obo:MI_0857 . obo:MI_1256 obo:IAO_0000115 "Luminescent dyes such as cyanines,commonly used for DNA labelling." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-08-10T02:18:02Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1256" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "luminscent dye label" ; rdfs:subClassOf obo:MI_0373 . obo:MI_1257 obo:IAO_0000115 "Rhodamines are supplements to fluoresceins, as they offer longer wavelength emission maxima and provide opportunities for multicolor labeling or staining." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-08-10T02:39:00Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1257" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "rhodamine label" ; rdfs:subClassOf obo:MI_0857 . obo:MI_1258 obo:IAO_0000115 "Tetramethyl rhodamine - a derivative of rhodamine." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-08-10T02:44:52Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1258" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "tetramethyl rhodamine label" ; rdfs:subClassOf obo:MI_1257 . obo:MI_1259 obo:IAO_0000115 "The thiol reactive acrylodan (6-acryloyl-2-dimethylaminonaphthalene) generally reacts with thiols more slowly than iodoacetamides or maleimides, but does form very strong thioether bonds that are expected to remain stable under conditions required for complete amino acid analysis. The fluorescence emission peak and intensity of these adducts are particularly sensitive to conformational changes or ligand binding." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-08-10T02:55:26Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:hasRelatedSynonym "6-acryloyl-2-dimethylaminonaphthalene" ; oboInOwl:id "MI:1259" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "acrylodan label" ; rdfs:subClassOf obo:MI_0857 . obo:MI_1260 obo:IAO_0000115 "Pyrene is a polycyclic aromatic hydrocarbon (PAH) consisting of four fused benzene rings, resulting in a flat aromatic system. The chemical formula is C16H10. Its derivatives are valuable molecular probes via fluorescence spectroscopy, having a high quantum yield and lifetime." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-08-10T03:09:54Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1260" ; a owl:Class ; rdfs:label "pyrene label" ; rdfs:subClassOf obo:MI_0857 . obo:MI_1261 obo:IAO_0000115 "Oregon Green 488 and Oregon Green 514 dyes are fluorinated analogs of fluoresceins" ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-08-10T03:17:05Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1261" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "oregon green label" ; rdfs:subClassOf obo:MI_0939 . obo:MI_1262 obo:IAO_0000115 "Interologous Interaction Database is an on-line database of known and predicted mammalian and eukaryotic protein-protein interactions." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-10-22T02:57:59Z" ; oboInOwl:hasDbXref "url:http://iid.ophid.utoronto.ca/iid/" ; oboInOwl:hasExactSynonym "I2D", "IID", "Interologous Interaction Database" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1262" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "iid" ; rdfs:subClassOf obo:MI_0461, obo:MI_0973 . obo:MI_1263 obo:IAO_0000115 "Molecular Connections Private Limited is an in silico discovery Services Company with expertise in drug-discovery, informatics and information technology. They perform pro bono work for the IMEx Consortium. http://www.molecularconnections.com" ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-10-22T03:03:01Z" ; oboInOwl:hasExactSynonym "Molecular Connections" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:hasRelatedSynonym "MolCon" ; oboInOwl:id "MI:1263" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "molecular connections" ; rdfs:subClassOf obo:MI_0461, obo:MI_0973 . obo:MI_1264 obo:IAO_0000115 "Norwegian University of Science and Technology. www.ntnu.no/home." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-10-22T03:15:27Z" ; oboInOwl:hasExactSynonym "NTNU" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1264" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "ntnu" ; rdfs:subClassOf obo:MI_0489 . obo:MI_1265 obo:IAO_0000115 "In the split-ubiquitin system, two integral membrane proteins to be studied are fused to two different ubiquitin moieties: a C-terminal ubiquitin moiety (residues 35-76) and an N-terminal ubiquitin moiety (residues 1-34). These fused proteins are called the bait and prey, respectively. In addition to being fused to an integral membrane protein, the Cub moiety is also fused to a transcription factor that can be cleaved off by ubiquitin specific proteases." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-10-24T11:08:40Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1265" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "ubiquitin reconstruction tag" ; rdfs:subClassOf obo:MI_0240 . obo:MI_1266 obo:IAO_0000115 "A C-terminal ubiquitin moiety (cub, residues 35-76) plus a transcription factor that can be cleaved off by ubiquitin specific proteases. Regarded as attached to the bait molecules in ubiquitin reconstruction assays." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-10-24T11:10:19Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:hasRelatedSynonym "c-terminal ubiquitin tag" ; oboInOwl:id "MI:1266" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "cub" ; rdfs:subClassOf obo:MI_1265 . obo:MI_1267 obo:IAO_0000115 "N-terminal ubiquitin moiety (nub, residues 1-34)." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-10-24T11:12:47Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:hasRelatedSynonym "N-terminal ubiquitin tag" ; oboInOwl:id "MI:1267" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "nub" ; rdfs:subClassOf obo:MI_1265 . obo:MI_1268 obo:IAO_0000115 "N-terminal ubiquitin moiety (residues 1-34) containing a Ile13Gly mutation." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-10-24T11:31:11Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:hasRelatedSynonym "Ile13Gly N-terminal ubiquitin tag" ; oboInOwl:id "MI:1268" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "nubg" ; rdfs:subClassOf obo:MI_1267 . obo:MI_1269 obo:IAO_0000115 "An identical protein sequence is coded for by the multiple genes within the same organism. These proteins may previously be merged into a single entry by UniProt and subsequently demerged." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2012-11-28T03:23:28Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1269" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "duplicated protein" ; rdfs:subClassOf obo:MI_1341 . obo:MI_1270 obo:IAO_0000115 "Contains a polyhistidine sequence, the Xpress epitope (part of bacteriophage T7 gene 10 protein) and an enterokinase cleavage site. Anti-Xpress antibodies recognise the Xpress epitope sequence found in this leader peptide. Asp-Leu-Tyr-Asp-Asp-Asp-Asp-Lys." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2013-05-30T08:29:27Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1270" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "xpress tag" ; rdfs:subClassOf obo:MI_0507 . obo:MI_1271 obo:IAO_0000115 """An effect in which the phenotype of one genetic perturbation is enhanced by a second perturbation to a severity/penetrance beyond (further from wild type) that expected by the superimposition or addition of effects of the individual perturbations. With respect to any single quantifiable phenotype, this may be expressed as an inequality as: ab < E < wt OR wt < E < ab where 'ab' is the observed phenotype value of the double perturbation, 'E' is the expected phenotype value of the double perturbation, and 'wt' is the wild type phenotype value.""" ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2013-06-05T19:12:17Z" ; oboInOwl:hasExactSynonym "enhancing diverging genetic interaction" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:hasRelatedSynonym "aggravating interaction" ; oboInOwl:id "MI:1271" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "genetic enhancement (sensu unexpected)" ; rdfs:subClassOf obo:MI_0933, obo:MI_2380 . obo:MI_1272 obo:IAO_0000115 """An effect in which individual perturbations of two different genes result in different mutant phenotypes (which are traits measured on the same quantitative scale but each significantly deviating, in the same direction, from wild type), and the resulting phenotype of their combination is equal to that of only one of the perturbations. With respect to any single quantifiable phenotype, this may be expressed as an inequality as: ((a* < b < wt) OR (wt < b < a*)) AND (ab = a OR ab = b) where 'a' and 'b' are the observed phenotype values of the individual perturbations ('a*' being the most severe of the two), 'ab' is the observed phenotype value of the double perturbation, and 'wt' is the wild type phenotype value.""" ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2013-06-05T20:05:15Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1272" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "converging genetic epistasis" ; rdfs:subClassOf obo:MI_0935, obo:MI_1284, obo:MI_2385 . obo:MI_1273 obo:IAO_0000115 """An effect in which individual perturbations of two different genes result in the same mutant phenotype to varying degrees of severity/penetrance and the resulting phenotype of their combination is equal in severity/penetrance to the most severe/penetrant of the individual perturbations. With respect to any single quantifiable phenotype, this may be expressed as an inequality as: ab = a* < b < wt OR wt < b < a* = ab where 'a' and 'b' are the observed phenotype values of the individual perturbations ('a*' being the most severe of the two), 'ab' is the observed phenotype value of the double perturbation, and 'wt' is the wild type phenotype value.""" ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2013-06-05T20:11:27Z" ; oboInOwl:hasExactSynonym "cisphenotypic masking genetic interaction" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1273" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "maximal genetic epistasis" ; rdfs:subClassOf obo:MI_1272 . obo:MI_1274 obo:IAO_0000115 """An effect in which individual perturbations of two different genes result in the same mutant phenotype to varying degrees of severity/penetrance and the resulting phenotype of their combination is equal in severity/penetrance to the least severe/penetrant of the individual perturbations. With respect to any single quantifiable phenotype, this may be expressed as an inequality as: a* < ab = b < wt OR wt < b = ab < a* where 'a' and 'b' are the observed phenotype values of the individual perturbations ('a*' being the most severe of the two), 'ab' is the observed phenotype value of the double perturbation, and 'wt' is the wild type phenotype value.""" ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2013-06-05T20:13:14Z" ; oboInOwl:hasExactSynonym "cisphenotypic semi-suppressing converging genetic interaction", "cisphenotypic semi-suppressing genetic interaction" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1274" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "minimal genetic epistasis" ; rdfs:subClassOf obo:MI_1272, obo:MI_1282 . obo:MI_1275 obo:IAO_0000115 """OBSOLETE: An effect in which individual perturbations of two different genes result in different mutant phenotypes (which are EITHER traits measured on the same quantitative scale but each significantly deviating, in opposite directions, from wild type, OR completely (qualitatively) different phenotypes), and the resulting phenotype of their combination is equal to that of only one of the perturbations. With respect to any single quantifiable phenotype, this may be expressed as an inequality as: (a < wt < b) AND (ab = a OR ab = b) OR (a != wt AND b != wt AND a != b) AND (ab = a OR ab = b) where 'a' and 'b' are the observed phenotype values of the individual perturbations, 'ab' is the observed phenotype value of the double perturbation, 'wt' is the wild type phenotype value, and 'a != b' indicates qualitatively different phenotypes.""" ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2013-06-05T20:22:53Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1275" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "obsolete neutral epistasis" ; owl:deprecated true . obo:MI_1276 obo:IAO_0000115 """An effect in which individual perturbations of two different genes result in opposite mutant phenotypes (traits measured on the same scale but each on opposing sides relative to the wild type phenotype), and the resulting phenotype of their combination is equal to that of only one of the perturbations. With respect to any single quantifiable phenotype, this may be expressed as an inequality as: (a < wt < b) AND (ab = a OR ab = b) where 'a' and 'b' are the observed phenotype values of the individual perturbations, 'ab' is the observed phenotype value of the double perturbation, and 'wt' is the wild type phenotype value.""" ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2013-06-05T20:25:26Z" ; oboInOwl:hasAlternativeId "MI:1285" ; oboInOwl:hasExactSynonym "transphenotypic masking genetic interaction" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1276" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "opposing genetic epistasis" ; rdfs:subClassOf obo:MI_1284, obo:MI_2387 . obo:MI_1277 obo:IAO_0000115 """An effect in which individual perturbations of two different genes result in different mutant phenotypes (which are traits that cannot be measured on the same scale and, hence, qualitatively different), and the resulting phenotype of their combination is equal to that of only one of the perturbations. This may be expressed as an inequality as: (a != wt AND b != wt AND a != b) AND (ab = a OR ab = b) where 'a' and 'b' are the observed phenotypes of the individual perturbations, 'ab' is the observed phenotype of the double perturbation, 'wt' is the wild type phenotype and 'a != b' indicates qualitatively different phenotypes.""" ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2013-06-05T20:26:38Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1277" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "qualitative genetic epistasis" ; rdfs:subClassOf obo:MI_0797 . obo:MI_1278 obo:IAO_0000115 """An effect in which individual perturbations of different genes result in the same mutant phenotype (but, perhaps, to varying degrees of severity/penetrance) and the resulting phenotype of their combination is more severe/penetrant (further from wild type) than expected by the superimposition or addition of effects of the individual perturbations. With respect to any single quantifiable phenotype, this may be expressed as an inequality as: ab < a* <= b < wt [E = a*] OR wt < b <= a* < ab [E = a*] where 'a' and 'b' are the observed phenotype values of the individual perturbations ('a*' being the most severe of the two), 'ab' is the observed phenotype value of the double perturbation, 'E' is the expected phenotype value of the double perturbation, and 'wt' is the wild type phenotype value.""" ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2013-06-05T20:31:30Z" ; oboInOwl:hasExactSynonym "cisphenotypic enhancing diverging genetic interaction" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1278" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "mutual genetic enhancement (sensu unexpected)" ; rdfs:subClassOf obo:MI_1271, obo:MI_2401 . obo:MI_1279 obo:IAO_0000115 """An effect in which the phenotype of one genetic perturbation is enhanced by a second perturbation (which, on its own, has no effect on the phenotype in question) to a severity/penetrance beyond (further from wild type) that of the original phenotype. With respect to any single quantifiable phenotype, this may be expressed as an inequality as: ab < a < b = wt [E = a] OR wt = b < a < ab [E = a] where 'a' and 'b' are the observed phenotype values of the individual perturbations, 'ab' is the observed phenotype value of the double perturbation, 'E' is the expected phenotype value of the double perturbation, and 'wt' is the wild type phenotype value.""" ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2013-06-05T20:33:13Z" ; oboInOwl:hasExactSynonym "monophenotypic enhancing diverging genetic interaction", "monophenotypic enhancing genetic interaction", "unilateral genetic enhancement" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1279" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "monophenotypic genetic enhancement" ; rdfs:subClassOf obo:MI_1271, obo:MI_2382 . obo:MI_1280 obo:IAO_0000115 """An effect in which individual perturbations of different genes result in the same mutant phenotype (but, perhaps, to varying degrees of severity/penetrance) and the resulting phenotype of their combination is less severe/penetrant than expected from the original phenotypes. With respect to any single quantifiable phenotype, this may be expressed as an inequality as: (a* <= b < wt) AND (a* < ab <= wt) [E = a*] OR (wt < b <= a*) AND (wt <= ab < a*) [E = a*] where 'a' and 'b' are the observed phenotype values of the individual perturbations ('a*' being the most severe of the two), 'ab' is the observed phenotype value of the double perturbation, 'E' is the expected phenotype value of the double perturbation, and 'wt' is the wild type phenotype value.""" ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2013-06-05T20:35:53Z" ; oboInOwl:hasExactSynonym "cisphenotypic suppressing converging genetic interaction", "cisphenotypic suppressing genetic interaction" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1280" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "cisphenotypic genetic suppression" ; rdfs:subClassOf obo:MI_0796, obo:MI_2385, obo:MI_2389 . obo:MI_1281 obo:IAO_0000115 """An effect in which individual perturbations of different genes result in the same mutant phenotype (but, perhaps, to varying degrees of severity/penetrance) and the resulting combination is wild type. With respect to any single quantifiable phenotype, this may be expressed as an inequality as: a* <= b < ab = wt OR wt = ab < b <= a* OR a < wt = ab < b where 'a' and 'b' are the observed phenotype values of the individual perturbations ('a*' being the most severe of the two), 'ab' is the observed phenotype value of the double perturbation, and 'wt' is the wild type phenotype value.""" ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2013-06-05T20:37:41Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1281" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "mutual genetic suppression (complete)" ; rdfs:subClassOf obo:MI_1290, obo:MI_2389 . obo:MI_1282 obo:IAO_0000115 """An effect in which individual perturbations of different genes result in the same mutant phenotype (but, perhaps, to varying degrees of severity/penetrance) and the resulting phenotype of their combination is less severe/penetrant than expected, but not wild type. With respect to any single quantifiable phenotype, this may be expressed as an inequality as: (a* <= b < wt) AND (a* < ab < wt) [E = a*] OR (wt < b <= a*) AND (wt < ab < a*) [E = a*] where 'a' and 'b' are the observed phenotype values of the individual perturbations ('a*' being the most severe of the two), 'ab' is the observed phenotype value of the double perturbation, 'E' is the expected phenotype value of the double perturbation, and 'wt' is the wild type phenotype value.""" ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2013-06-05T20:39:12Z" ; oboInOwl:hasExactSynonym "cisphenotypic sub-suppressing converging genetic interaction", "cisphenotypic sub-suppressing genetic interaction" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1282" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "cisphenotypic genetic suppression (partial)" ; rdfs:subClassOf obo:MI_1280, obo:MI_1291 . obo:MI_1283 obo:IAO_0000115 """An effect in which individual perturbations of different genes result in the same mutant phenotype to varying degrees of severity/penetrance and the resulting phenotype of their combination has a phenotype more severe/penetrant than the least severe/penetrant and less severe/penetrant than the most severe/penetrant of the individual perturbations. With respect to any single quantifiable phenotype, this may be expressed as an inequality as: a* < ab < b < wt [E = a*] OR wt < b < ab < a* [E = a*] where 'a' and 'b' are the observed phenotype values of the individual perturbations ('a*' being the most severe of the two), 'ab' is the observed phenotype value of the double perturbation, 'E' is the expected phenotype value of the double perturbation, and 'wt' is the wild type phenotype value.""" ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2013-06-05T20:43:52Z" ; oboInOwl:hasExactSynonym "cisphenotypic inter-suppressing converging genetic interaction", "genetic suppression-enhancement" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1283" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "cisphenotypic inter-suppressing genetic interaction" ; rdfs:subClassOf obo:MI_1282 . obo:MI_1284 obo:IAO_0000115 """An effect in which individual perturbations of two different genes result in different mutant phenotypes (which are traits measured on the same quantitative scale but each significantly deviating, in any direction, from wild type), and the resulting phenotype of their combination is equal to that of only one of the perturbations. With respect to any single quantifiable phenotype, this may be expressed as an inequality as: (a != wt AND b != wt AND a != b) AND (ab = a OR ab = b) where 'a' and 'b' are the observed phenotype values of the individual perturbations, 'ab' is the observed phenotype value of the double perturbation, 'wt' is the wild type phenotype value and 'a != b' indicates quantitatively different phenotypes.""" ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2013-06-05T20:47:35Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1284" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "quantitative genetic epistasis" ; rdfs:subClassOf obo:MI_0797 . obo:MI_1285 obo:IAO_0000115 """OBSOLETE: An effect in which individual perturbations of two different genes result in opposite mutant phenotypes (traits measured on the same scale but each on opposing sides relative to the wild type phenotype), and the resulting phenotype of their combination is equal to that of only one of the perturbations. With respect to any single quantifiable phenotype, this may be expressed as an inequality as: (a < wt < b) AND (ab = a OR ab = b) where 'a' and 'b' are the observed phenotype values of the individual perturbations, 'ab' is the observed phenotype value of the double perturbation, and 'wt' is the wild type phenotype value.""" ; obo:IAO_0000231 obo:IAO_0000227 ; obo:IAO_0100001 obo:MI_1276 ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2013-06-05T20:51:51Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1285" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:comment """Term replaced by http://purl.obolibrary.org/obo/MI_1276""" ; rdfs:label "obsolete opposing epistasis" ; owl:deprecated true . obo:MI_1286 obo:IAO_0000115 """An effect in which the observed phenotype of a double perturbation is opposite (relative to the wild type phenotype) to that which is expected upon the double perturbation. With respect to any single quantifiable phenotype, this may be expressed as an inequality as: ab < wt < E OR E < wt < ab where 'ab' is the observed phenotype value of the double perturbation, 'E' is the expected phenotype value of the double perturbation, and 'wt' is the wild type phenotype value.""" ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2013-06-05T21:04:18Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1286" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "surpassing genetic interaction" ; rdfs:subClassOf obo:MI_0208 . obo:MI_1287 obo:IAO_0000115 """An effect in which individual perturbations of different genes result in the same mutant phenotype (but, perhaps, to varying degrees of severity/penetrance) and the resulting phenotype of their combination is opposite (relative to wild type) to that expected from the original phenotypes. With respect to any single quantifiable phenotype, this may be expressed as an inequality as: a* <= b < wt < ab [E = a*] OR ab < wt < b <= a* [E = a*] where 'a' and 'b' are the observed phenotype values of the individual perturbations ('a*' being the most severe of the two), 'ab' is the observed phenotype value of the double perturbation, 'E' is the expected phenotype value of the double perturbation, and 'wt' is the wild type phenotype value.""" ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2013-06-05T21:06:09Z" ; oboInOwl:hasExactSynonym "cisphenotypic super-suppressing genetic interaction" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1287" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "mutual genetic over-suppression" ; rdfs:subClassOf obo:MI_1286, obo:MI_2385, obo:MI_2388 . obo:MI_1288 obo:IAO_0000115 """An effect in which two individual perturbations result in opposite mutant phenotypes (relative to wild type) and their combination results in a phenotype that is more severe than the phenotype observed with the same directionality. With respect to any single quantifiable phenotype, this may be expressed as an inequality as: a < wt < b < ab OR ab < a < wt < b where 'a' and 'b' are the observed phenotype values of the individual perturbations, 'ab' is the observed phenotype value of the double perturbation, and 'wt' is the wild type phenotype value.""" ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2013-06-05T21:11:03Z" ; oboInOwl:hasExactSynonym "genetic over-suppression-enhancement" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1288" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "transphenotypic enhancing genetic interaction" ; rdfs:subClassOf obo:MI_0208, obo:MI_2387 . obo:MI_1289 obo:IAO_0000115 """OBSOLETE: An effect when two individual perturbations result in opposite mutant phenotypes (relative to wild type) and their combination results in a phenotype that is intermediate to the individual mutant phenotypes, but greater or less than wild type. With respect to any single quantifiable phenotype, this may be expressed as an inequality as: (a < wt < b) AND (a < ab < b) AND (ab != wt) where 'a' and 'b' are the observed phenotype values of the individual perturbations, 'ab' is the observed phenotype value of the double perturbation, and 'wt' is the wild type phenotype value.""" ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2013-06-05T21:15:34Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1289" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "obsolete phenotype bias" ; owl:deprecated true . obo:MI_1290 obo:IAO_0000115 """An effect in which the perturbation of one gene results in complete suppression (to wild type) of the mutant phenotype caused by perturbation of another gene. The phenotype of the suppressing perturbation may or may not be known. With respect to any single quantifiable phenotype, this may be expressed as an inequality as: wt = ab != a = E where 'a' is the observed phenotype values of an individual perturbation, 'ab' is the observed phenotype value of the double perturbation, 'E' is the expected phenotype value of the double perturbation, and 'wt' is the wild type phenotype value.""" ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2013-06-05T21:34:57Z" ; oboInOwl:hasExactSynonym "all-suppressing genetic interaction" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1290" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "genetic suppression (complete)" ; rdfs:subClassOf obo:MI_2379 . obo:MI_1291 obo:IAO_0000115 """An effect in which the perturbation of one gene results in the amelioration or lessening of the severity/penetrance of a mutant phenotype caused by perturbation of another gene, in effect making the organism more, but not completely, \"wild type\" in character with regards to the phenotype in question. The phenotype of the suppressing perturbation may or may not be known. With respect to any single quantifiable phenotype, this may be expressed as an inequality as: a* < ab < wt [E = a*] OR wt < ab < a* [E = a*] where 'a' and 'b' are the observed phenotype values of the individual perturbations ('a*' being the most severe of the two), 'ab' is the observed phenotype value of the double perturbation, 'E' is the expected phenotype value of the double perturbation, and 'wt' is the wild type phenotype value.""" ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2013-06-05T21:36:07Z" ; oboInOwl:hasExactSynonym "sub-suppressing genetic interaction" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1291" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "genetic suppression (partial)" ; rdfs:subClassOf obo:MI_2379 . obo:MI_1292 obo:IAO_0000115 """An effect in which the perturbation of one gene, which has no effect on the phenotype in question, is combined with the perturbation of another gene, which causes the mutant phenotype in question, and results in the amelioration or lessening of the severity/penetrance of the mutant phenotype, in effect making the organism more \"wild type\" in character with regards to the phenotype in question. With respect to any single quantifiable phenotype, this may be expressed as an inequality as: a < ab <= b = wt [E = a] OR wt = b <= ab < a [E = a] where 'a' and 'b' are the observed phenotype values of the individual perturbations, 'ab' is the observed phenotype value of the double perturbation, 'E' is the expected phenotype value of the double perturbation, and 'wt' is the wild type phenotype value.""" ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2013-06-05T21:37:28Z" ; oboInOwl:hasExactSynonym "monophenotypic suppressing converging genetic interaction", "monophenotypic suppressing genetic interaction", "unilateral genetic suppression" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1292" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "monophenotypic genetic suppression" ; rdfs:subClassOf obo:MI_0796, obo:MI_2382 . obo:MI_1293 obo:IAO_0000115 """An effect in which the perturbation of one gene, which has no effect on the phenotype in question, is combined with the perturbation of another gene, which causes the mutant phenotype in question, and results in the complete suppression (to wild type) of the mutant phenotype. With respect to any single quantifiable phenotype, this may be expressed as an inequality as: a < ab = b = wt [E = a] OR wt = b = ab < a [E = a] where 'a' and 'b' are the observed phenotype values of the individual perturbations, 'ab' is the observed phenotype value of the double perturbation, 'E' is the expected phenotype value of the double perturbation, and 'wt' is the wild type phenotype value.""" ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2013-06-05T21:38:36Z" ; oboInOwl:hasExactSynonym "monophenotypic all-suppressing converging genetic interaction", "monophenotypic all-suppressing genetic interaction", "unilateral genetic suppression (complete)" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1293" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "monophenotypic genetic suppression (complete)" ; rdfs:subClassOf obo:MI_1290, obo:MI_1292 . obo:MI_1294 obo:IAO_0000115 """An effect in which the perturbation of one gene, which has no effect on the phenotype in question, is combined with the perturbation of another gene, which causes the mutant phenotype in question, and results in the amelioration or lessening of the severity/penetrance of the mutant phenotype, in effect making the organism more, but not completely, \"wild type\" in character with regards to the phenotype in question. With respect to any single quantifiable phenotype, this may be expressed as an inequality as: a < ab < b = wt [E = a] OR wt = b < ab < a [E = a] where 'a' and 'b' are the observed phenotype values of the individual perturbations, 'ab' is the observed phenotype value of the double perturbation, 'E' is the expected phenotype value of the double perturbation, and 'wt' is the wild type phenotype value.""" ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2013-06-05T21:39:32Z" ; oboInOwl:hasExactSynonym "monophenotypic sub-suppressing converging genetic interaction", "monophenotypic sub-suppressing genetic interaction", "unilateral genetic suppression (partial)" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1294" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "monophenotypic genetic suppression (partial)" ; rdfs:subClassOf obo:MI_1292 . obo:MI_1295 obo:IAO_0000115 """An effect in which the perturbation of one gene (which has no individual effect on the phenotype in question), when combined with a perturbation of another gene (which causes the phenotype in question), results in a mutant phenotype opposite (relative to wild type) to that of the original phenotype. With respect to any single quantifiable phenotype, this may be expressed as an inequality as: E = a < b = wt < ab OR ab < wt = b < a = E where 'a' and 'b' are the observed phenotype values of the individual perturbations, 'ab' is the observed phenotype value of the double perturbation, 'E' is the expected phenotype value of the double perturbation, and 'wt' is the wild type phenotype value.""" ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2013-06-05T21:54:08Z" ; oboInOwl:hasExactSynonym "monophenotypic super-suppressing genetic interaction", "unilateral genetic over-suppression" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1295" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "monophenotypic genetic over-suppression" ; rdfs:subClassOf obo:MI_1286, obo:MI_2382, obo:MI_2388 . obo:MI_1296 obo:IAO_0000115 "The presence of particular residues,for example those altered through post-translational modification, can be identified by amino acid analysis. Popular techniques for this include mass spectrometry or residue-specific antibodies." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2013-06-06T07:49:49Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1296" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "amino acid analysis" ; rdfs:subClassOf obo:MI_0659 . obo:MI_1297 obo:IAO_0000115 "The presence of amino acid residues phosphorylated as a result of post-translational modification, can be identified by amino acid analysis. Popular techniques for this include mass spectrometry or residue-specific antibodies." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2013-06-06T07:55:30Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1297" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "phosphoamino acid analysis" ; rdfs:subClassOf obo:MI_1296 . obo:MI_1298 obo:IAO_0000115 "A classification of the structural characteristics of a macromolecular complex." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2013-06-06T08:52:34Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1298" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "complex type" ; rdfs:subClassOf obo:MI_0314 . obo:MI_1299 obo:IAO_0000115 "A description of the molecule types of which a macromolecular complex is composed." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2013-06-06T08:55:37Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1299" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "complex composition" ; rdfs:subClassOf obo:MI_0314 . obo:MI_1300 obo:IAO_0000115 "The protein chains present in the complex are not found as independent stable structures in vivo." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2013-06-06T08:57:32Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1300" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "obligate complex" ; rdfs:subClassOf obo:MI_1298 . obo:MI_1301 obo:IAO_0000115 "Protein chains present in the complex may also be found as independent stable proteins in vivo." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2013-06-06T09:02:52Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1301" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "non-obligate complex" ; rdfs:subClassOf obo:MI_1298 . obo:MI_1302 obo:IAO_0000115 "A stable set (2 or more) of interacting molecules which can be co-purified and have been shown to exist as a functional unit in vivo." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2013-06-06T09:05:59Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1302" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "stable complex" ; rdfs:subClassOf obo:MI_1298 . obo:MI_1303 obo:IAO_0000115 "A macromolecular complex of which the participants associate and dissociate in vivo. Weak transient complexes feature a dynamic oligomeric equilibrium in solution where the interaction is broken and formed continuously. Strong transient associations that require a molecular trigger to shift the oligomeric equilibrium." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2013-06-06T09:09:01Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1303" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "transient complex" ; rdfs:subClassOf obo:MI_1298 . obo:MI_1304 obo:IAO_0000115 "A group of molecules linked by a high degree of similarity of sequence and/or function and not easily separated by participant identification methods." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2013-06-06T09:20:00Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1304" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "molecule set" ; rdfs:subClassOf obo:MI_0313 . obo:MI_1305 obo:IAO_0000115 "A group of interactors hypothesized to perform a specified function. Example: Two splice variants of Raptor mRNA encode closely related proteins. One (member) has been shown to participate in formation of active mTORC complex; the other (candidate) is thought to do so." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2013-06-06T10:09:09Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1305" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "candidate set" ; rdfs:subClassOf obo:MI_1304 . obo:MI_1306 obo:IAO_0000115 "A group of interactors that can be counted in principle but not in practice, such as mRNA or long-chain fatty acid. Examples - ceruloplasmin mRNA, palmitic acid." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2013-06-06T10:19:10Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1306" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "open set" ; rdfs:subClassOf obo:MI_1304 . obo:MI_1307 obo:IAO_0000115 "Two or more interactors, grouped to denote interchangeable function. Thus the addition of a single nucleotide residue during RNA transcription could be annotated with the definedSet NTP (members ATP, CTP, GTP, and UTP)." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2013-06-06T10:22:53Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1307" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "defined set" ; rdfs:subClassOf obo:MI_1304 . obo:MI_1308 obo:IAO_0000115 """Used to specify the identity of the residue (or residues) introduced by mutation or variant (of child terms). The attribute would be used concurrently with the description provided in the feature name.""" ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2013-06-06T10:26:19Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1308" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "resulting sequence" ; rdfs:subClassOf obo:MI_0668 . obo:MI_1309 obo:IAO_0000115 "Hydrolytic reactions that release ADP-ribose." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2013-06-06T10:31:58Z" ; oboInOwl:hasExactSynonym "mono-ADP-ribosylhydrolase" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1309" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "de-ADP-ribosylation assay" ; rdfs:subClassOf obo:MI_0415 . obo:MI_1310 obo:IAO_0000115 "Measure of hydrolytic reactions that release ADP-ribose." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2013-06-06T10:34:18Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:hasRelatedSynonym "mono-ADP-ribosylhydrolase reaction" ; oboInOwl:id "MI:1310" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "de-ADP-ribosylation reaction" ; rdfs:subClassOf obo:MI_0414 . obo:MI_1311 obo:IAO_0000115 "Differential scanning calorimetry (DSC) is a thermoanalytical technique in which the difference in the amount of heat required to increase the temperature of a sample and reference in solution is measured as a function of temperature. By measuring the temperature dependence of this partial heat capacity, a basic thermodynamic property, DSC gives immediate access to the thermodynamic mechanism that governs a conformational equilibrium, for example between a protein complex and its individual participants." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2013-06-06T10:39:30Z" ; oboInOwl:hasExactSynonym "dsc" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1311" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "differential scanning calorimetry" ; rdfs:subClassOf obo:MI_0013 . obo:MI_1312 obo:IAO_0000115 "Method allowing the detection of interactions between two or more molecules by their very close proximity or the overlap of their respective bands in a SDS gel containing urea as an additional denaturing agent." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2013-06-06T10:43:24Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:hasRelatedSynonym "acetic acid/urea/triton PAGE" ; oboInOwl:id "MI:1312" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "aut-page" ; rdfs:subClassOf obo:MI_0807 . obo:MI_1313 obo:IAO_0000115 "Methods depend on a modification that only takes place with the close proximity of two molecules - a protein fused to the bait can then modify any neighbouring prey proteins, for example. The resulting tag can be used for isolation and/or identification." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2013-06-06T11:20:43Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1313" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "proximity labelling technology" ; rdfs:subClassOf obo:MI_2198 . obo:MI_1314 obo:IAO_0000115 "A promiscuous biotin protein ligase is fused to the bait protein, neighbouring prey are then biotinylated. The biotin tag may be used for isolation and/or identification." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2013-06-06T11:23:53Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:hasRelatedSynonym "BioID" ; oboInOwl:id "MI:1314" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "proximity-dependent biotin identification" ; rdfs:subClassOf obo:MI_1313 . obo:MI_1315 obo:IAO_0000115 "The most accepted name in the literature for this complex." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2013-10-14T15:00:37Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1315" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "complex recommended name" ; rdfs:subClassOf obo:MI_1041 . obo:MI_1316 obo:IAO_0000115 "A name for a complex built of the component parts of that complex." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2013-10-14T15:04:57Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1316" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "complex systematic name" ; rdfs:subClassOf obo:MI_1041 . obo:MI_1317 obo:IAO_0000115 "The ELM resource provides a database of curated short linear motif classes and instances, as well as a sequence analysis tool to detect putative short linear motif instances in query sequences. http://elm.eu.org/" ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2013-10-22T09:49:10Z" ; oboInOwl:hasDbXref "id-validation-regexp:", "search-url:" ; oboInOwl:hasExactSynonym "elm" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1317" ; a owl:Class ; rdfs:label "eukaryotic linear motif resource" ; rdfs:subClassOf obo:MI_0447 . obo:MI_1318 obo:IAO_0000115 "Any molecule that is able to transfer a sulphate group to another chemical species." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2014-01-08T07:51:29Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:hasRelatedSynonym "sulphate donor" ; oboInOwl:id "MI:1318" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "sulfate donor" ; rdfs:subClassOf obo:MI_0918 . obo:MI_1319 obo:IAO_0000115 "Molecule to which a sulphate group may be transferred from a sulphate donor." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2014-01-08T07:52:46Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:hasRelatedSynonym "sulphate acceptor" ; oboInOwl:id "MI:1319" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "sulfate acceptor" ; rdfs:subClassOf obo:MI_0919 . obo:MI_1320 obo:IAO_0000115 "Traditional yeast two hybrid assays are not suitable for the analysis of membrane proteins, as they require the interactions to occur in the nucleus. Methods have been specifically developed to assay for interactions of membrane proteins with both cytosolic or membrane-bound partners." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2014-01-08T10:14:46Z" ; oboInOwl:hasExactSynonym "MYTH" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1320" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "membrane yeast two hybrid" ; rdfs:subClassOf obo:MI_2412 . obo:MI_1321 obo:IAO_0000115 "Upon interaction of N-terminal generated Ire1p-fusions, the Ire1p kinase domains oligomerize, transphosphorylate and activate their C-terminal RNAseL domains, which specifically splice the mRNA of a transcriptional activator, Hac1. The expression of the mature form of Hac1p leads to the interaction-specific expression of a reporter. Specifically designed to identify interactors of proteins found in the endoplasmic reticulum." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2014-01-08T10:17:38Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:hasRelatedSynonym "ER-MYTH", "endoplasmic reticulum membrane yeast-two hybrid" ; oboInOwl:id "MI:1321" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "ire1 reconstruction" ; rdfs:subClassOf obo:MI_2412 . obo:MI_1322 obo:IAO_0000115 "Fluorescent tag - maleimide couples to thiols." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2014-01-08T10:27:34Z" ; oboInOwl:hasExactSynonym "atto 465 maleimide", "atto465" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1322" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "atto 465" ; rdfs:subClassOf obo:MI_1092 . obo:MI_1323 obo:IAO_0000115 "The protein is expressed as a hybrid protein fused to a tag containing an alkaline phosphatase activity. Subsequent observation or measurement of alkaline phosphatase activity is used to identify the presence of the molecule in an interaction." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2014-01-08T11:00:36Z" ; oboInOwl:hasExactSynonym "tag alk phosphatase activity" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1323" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "tag visualisation by alkaline phosphatase activity" ; rdfs:subClassOf obo:MI_0980 . obo:MI_1324 obo:IAO_0000115 "Molecule present in media harvested from cultured cells." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2014-01-08T11:07:44Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1324" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "conditioned medium" ; rdfs:subClassOf obo:MI_0342 . obo:MI_1325 obo:IAO_0000115 "Measures the rate of a sulphate molecule transfer between two molecules." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2014-01-08T11:13:39Z" ; oboInOwl:hasExactSynonym "sulfertransferase" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:hasRelatedSynonym "sulfurtransfer assay", "sulphurtransferase assay" ; oboInOwl:id "MI:1325" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "sulfurtransferase assay" ; rdfs:subClassOf obo:MI_0415 . obo:MI_1326 obo:IAO_0000115 "Reaction where a phosphate is transferred between two proteins of a phosphorelay system. " ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2014-01-08T11:15:51Z" ; oboInOwl:hasExactSynonym "phosphotransfer" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1326" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "CLONE OF phosphotransfer reaction" ; owl:deprecated true . obo:MI_1327 obo:IAO_0000115 "Reaction where a sulfate group is transferred between two proteins" ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2014-01-08T11:16:12Z" ; oboInOwl:hasExactSynonym "sulfurtransfer", "sulphurtransfer reaction" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1327" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "sulfurtransfer reaction" ; rdfs:subClassOf obo:MI_0414 . obo:MI_1328 obo:IAO_0000115 "A class of labels derived from the benzopyrone coumarin." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2014-01-08T11:25:00Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1328" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "coumarin label" ; rdfs:subClassOf obo:MI_0857 . obo:MI_1329 obo:IAO_0000115 "The thiol-reactive coumarin, CPM is very weakly fluorescent until reacted with thiols producing a conjugate with excitation/emission maxima of ~384/470 nm." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2014-01-08T11:36:48Z" ; oboInOwl:hasExactSynonym "7-diethylamino-3-(4' maleimidylphenyl)-4-methylcoumarin" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1329" ; a owl:Class ; rdfs:label "cpm" ; rdfs:subClassOf obo:MI_1328 . obo:MI_1330 obo:IAO_0000115 "Fluorescent dye. Also acts as an uncoupler of oxidative phosphorylation in the mitochondria." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2014-01-08T12:01:24Z" ; oboInOwl:hasExactSynonym "2, 4-DNP", "2,4-Dinitrophenol", "dinitrophenol" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1330" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "dnp" ; rdfs:subClassOf obo:MI_0857 . obo:MI_1331 obo:IAO_0000115 "The Evidence Ontology (ECO) describes types of scientific evidence within the realm of biological research that can arise from laboratory experiments, computational methods, manual literature curation, and other means." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2014-01-08T12:48:33Z" ; oboInOwl:hasDbXref "id-validation-regexp:", "search-url:" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:hasRelatedSynonym "ECO" ; oboInOwl:id "MI:1331" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "evidence ontology" ; rdfs:subClassOf obo:MI_1336 . obo:MI_1332 obo:IAO_0000115 "The Cardiovascular Gene Annotation Initiative represents a collaboration between University College London and the European Bioinformatics Institute (EBI), funded by the British Heart Foundation. This annotation group is a member of the IMEx Consortium." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2014-01-08T12:56:27Z" ; oboInOwl:hasExactSynonym "BHF-UCL" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:hasRelatedSynonym "Cardiovascular Gene Annotation Initiative" ; oboInOwl:id "MI:1332" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "bhf-ucl" ; rdfs:subClassOf obo:MI_0461, obo:MI_0973 . obo:MI_1333 obo:IAO_0000115 """SEGUID's are SHA-1 keys written in canonical base64 form with trailing = characters removed. ROG identifiers concatenate a SEGUID with a numerical taxonomy identifier. Therefore, the allowable characters in a SEGUID or ROG identifier are (in ascending ASCII or Unicode value): +/0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz Lists of SEGUID or ROG identifiers were sorted in ascending ASCII-based lexicographical order.""" ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2014-01-09T11:17:18Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1333" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "rogid" ; rdfs:subClassOf obo:MI_1212 . obo:MI_1334 obo:IAO_0000115 "A global unique identifier to identify interactions that are identical. A RIG identifier (RIGID) is constructed by concatenating ROGID MI:1335 (after sorting them in ascending lexicographical order ), applying the SHA-1 algorithm to the resulting string, converting the digest to its base64 representation and removing all trailing \"=\" characters used for padding." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2014-01-09T11:17:32Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1334" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "rigid" ; rdfs:subClassOf obo:MI_0664, obo:MI_1212 . obo:MI_1335 obo:IAO_0000115 """Host-pathogen database. HPIDB integrates experimental PPIs from several public databases into a single, non-redundant web accessible resource. Manual curation is performed via the IntAct (ww.ebi.ac.uk/intact) curation interface. http://www.agbase.msstate.edu/hpi/main.html""" ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2014-03-03T11:43:31Z" ; oboInOwl:hasExactSynonym "HPIDB", "Host Pathogen Interaction database" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1335" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "hpidb" ; rdfs:subClassOf obo:MI_0461 . obo:MI_1336 obo:IAO_0000115 "Databases that contain information used to add additional information to experiments (meta-data)." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2014-01-20T11:56:03Z" ; oboInOwl:hasExactSynonym "experiment xref" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1336" ; oboInOwl:inSubset mi:Drugable, mi:PSI-MI_slim ; a owl:Class ; rdfs:label "experiment database" ; rdfs:subClassOf obo:MI_0444 . obo:MI_1337 obo:IAO_0000115 "The Experimental Factor Ontology provides a systematic description of many experimental variables, combining parts of several biological ontologies to additional new terms." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2014-01-20T11:58:47Z" ; oboInOwl:hasDbXref "id-validation-regexp:", "search-url:" ; oboInOwl:hasExactSynonym "Experimental facto ontology" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1337" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "efo" ; rdfs:subClassOf obo:MI_1336 . obo:MI_1338 obo:IAO_0000115 "Glu-Glu-Phe epitope tag, allowing its detection with rat monoclonal antibody YL1/2" ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2014-01-20T12:13:30Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:hasRelatedSynonym "Glu-Glu-Phe epitope tag" ; oboInOwl:id "MI:1338" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "eef tag" ; rdfs:subClassOf obo:MI_0507 . obo:MI_1339 obo:IAO_0000115 "Mutated green fluorescent protein with altered net charge and thus altered intermolecular properties, such as resistence to aggregation." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2014-01-20T13:13:03Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:hasRelatedSynonym "stGFP" ; oboInOwl:id "MI:1339" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "supercharged green fluorescent protein" ; rdfs:subClassOf obo:MI_0367 . obo:MI_1340 obo:IAO_0000115 "A central resource of single-colony, fully-sequenced cloned human ORFs which can be readily transferred to Gateway compatible destination vectors for various functional proteomics studies. This set of ORFs ranges in size from 75 to more than 10,000 base pairs, and contains over 1,000 ORFs from genes with multiple splice variants." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2014-04-08T16:15:19Z" ; oboInOwl:hasDbXref "search-url:" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1340" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "human orfeome collection" ; rdfs:subClassOf obo:MI_1096 . obo:MI_1341 obo:IAO_0000115 "Indicates that this protein is a member of a set of proteins with similar sequence and/or function." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2014-04-25T09:19:21Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1341" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "set member" ; rdfs:subClassOf obo:MI_0353 . obo:MI_1342 obo:IAO_0000115 "The quartz crystal microbalance is a physical technique that detects changes in the resonance frequency of an electrically driven quartz crystal with changes in mass. It provides qualitative and quantitative information about biomolecular interactions by translating changes in mass at the probe-immobilized surface of the crystal sensor into measurable changes in the resonant frequency of the quartz crystal. QCM-D enables real-time, label free measurements of molecular adsorption and/or interactions on various surfaces and is able to monitor conformational changes upon interactions." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2014-07-17T08:26:51Z" ; oboInOwl:hasExactSynonym "QCM-D", "Quartz Crystal Microbalance with Dissipation monitoring" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1342" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "qcmd" ; rdfs:subClassOf obo:MI_0968 . obo:MI_1343 obo:IAO_0000115 "Regulatory subunits of enzyme complexes can determine the activity level or specificity of catalytic subunits." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2014-07-17T08:43:17Z" ; oboInOwl:hasBroadSynonym "enzyme complex regulatory subunit" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1343" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "enzyme regulator" ; rdfs:subClassOf obo:MI_2274 . obo:MI_1344 obo:IAO_0000115 "Fluoresceine-derived label." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2014-07-17T08:47:44Z" ; oboInOwl:hasExactSynonym "ErIA", "erythrosin-5-iodoacetamide" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1344" ; a owl:Class ; rdfs:label "erythrosin iodoacetamide label" ; rdfs:subClassOf obo:MI_0939 . obo:MI_1345 obo:IAO_0000115 "A 9-amino acid peptide representing C terminus of bovine rhodopsin widely used as an epitope tag. A number of anti-rhodopsin antibodies recognize this epitope." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2014-09-19T14:24:43Z" ; oboInOwl:hasExactSynonym "1D4 tag", "rho1D4 tag" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1345" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "rho tag" ; rdfs:subClassOf obo:MI_0507 . obo:MI_1346 obo:IAO_0000115 "Database for NMR spectroscopy information on biomolecules hosted at the University of Wisconsin, Madison, US." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2014-09-19T14:42:33Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:hasRelatedSynonym "BioMagResBank", "Biological Magnetic Resonance Data Bank" ; oboInOwl:id "MI:1346" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "bmrb" ; rdfs:subClassOf obo:MI_0461 . obo:MI_1347 obo:IAO_0000115 "PRO provides an ontological representation of protein-related entities by explicitly defining them and showing the relationships between them. Each PRO term represents a distinct class of entities, including specific modified forms, orthologous isoforms, and protein complexes." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2014-09-26T14:06:25Z" ; oboInOwl:hasDbXref "id-validation-regexp:", "search-url:" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:hasRelatedSynonym "PRO" ; oboInOwl:id "MI:1347" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "protein ontology" ; rdfs:subClassOf obo:MI_0461 . obo:MI_1348 obo:IAO_0000115 "ChEMBL focuses on mapping the interactions of small molecules binding to their macromolecular targets." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2014-10-16T10:10:03Z" ; oboInOwl:hasDbXref "regexp:", "search-url:" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1348" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "chembl target" ; rdfs:subClassOf obo:MI_0683, obo:MI_1349 . obo:MI_1349 obo:IAO_0000115 "ChEMBL focuses on mapping the interactions of small molecules binding to their macromolecular targets." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2014-10-16T10:16:54Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1349" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "chembl" ; rdfs:subClassOf obo:MI_0461 . obo:MI_1350 obo:IAO_0000115 "Orphanet is a reference portal for information on rare diseases and orphan drugs. Its aim is to help improve the diagnosis, care and treatment of patients with rare diseases." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2014-10-16T10:27:01Z" ; oboInOwl:hasDbXref "id-validation-regexp:", "search-url:" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1350" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "orphanet" ; rdfs:subClassOf obo:MI_1336 . obo:MI_1351 obo:IAO_0000115 "Refers to the original experimentally verified object from which the described object has been derived." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2014-10-16T10:39:21Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1351" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "inferred-from" ; rdfs:subClassOf obo:MI_0353 . obo:MI_1352 obo:IAO_0000115 "In uracil interference assays, the DNA will be amplified by PCR in the presence of a mixture of TTP and dUTP to randomly replace thymine by deoxyuracil residues before the binding assay. If T nucleotides involved in protein-DNA interactions are replaced by deoxyuracil, protein binding is prevented. After isolating the protein-DNA complex, DNA is cleaved with uracil-N-glycosylase, which specifically targets uracil bases, and the products are electrophoresed on a denaturing polyacrylamide gel. As a result, DNA in which a thymine involved in binding is replaced by uracil will be depleted. Hence, although the pattern looks like a footprint, the blank region means \"contact points\"." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2015-01-28T10:12:25Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1352" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "uracil interference assay" ; rdfs:subClassOf obo:MI_0605 . obo:MI_1353 obo:IAO_0000115 "Epitope tag engineered onto the N- or C- terminus of a protein of interest so that the tagged protein can be analyzed and visualized by immunochemical methods. The recognized AU5 epitope represents the amino acid sequence TDFYLK." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2015-01-28T10:23:06Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1353" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "au5 tag" ; rdfs:subClassOf obo:MI_0507 . obo:MI_1354 obo:IAO_0000115 "Cleavage (hydrolysis) of a lipid molecule." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2015-02-03T13:18:55Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1354" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "lipase assay" ; rdfs:subClassOf obo:MI_0990 . obo:MI_1355 obo:IAO_0000115 "Reaction monitoring the cleavage (hydrolysis) or a lipid molecule." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2015-02-03T13:25:21Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1355" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "lipid cleavage" ; rdfs:subClassOf obo:MI_0194 . obo:MI_1356 obo:IAO_0000115 "The protein pairs, often initially identified by a separate 2-hybrid screening methodology, are subjected to a rigorous re-analysis which may include independent re-screening of the entire search space, retesting the assay in different strain backgrounds, and multiple retesting of identified protein pairs reversing bait-prey orientations. Orthogonal data from other experimental and bioinformatic approaches may also be used to support the identification of the final high-confidence protein pairs but the primary means of selection must be experimentally based. This method would be expected to identify protein pairs with a higher degree of confidence than any single protein complementation technique." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2015-02-03T13:36:20Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1356" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "validated two hybrid" ; rdfs:subClassOf obo:MI_0018 . obo:MI_1357 obo:IAO_0000115 "Provides unified access to the ncRNA sequence data supplied by the expert databases." ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2015-02-03T13:37:23Z" ; oboInOwl:hasDbXref "id-validation-regexp:", "search-url:" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:1357" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "RNAcentral" ; rdfs:subClassOf obo:MI_0683 . obo:MI_2002 obo:IAO_0000115 "DrugBank Accession number consisting of the 4 letter prefix and a 5 number suffix. Each Accession number is unique to the drug's generic name. The 4 letter suffix (APRD, EXPT, BIOD, NUTR) indicates the type of drug (APRD=approved small molecule drug, EXPT=experimental drug, BIOD=biotech drug, NUTR=nutraceutical or natural product). Biotech drugs consist of FDA approved peptide, protein or nucleic acid drugs, approved small molecule drugs are FDA approved non-biotech drugs, nutraceuticals are natural products (amino acids, vitamins, other metabolites) and experimental drugs include drugs under trial, pre-clinical drugs, unapproved drugs, well known inhibitors and possible toxins." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2002" ; oboInOwl:inSubset mi:Drugable ; a owl:Class ; rdfs:label "drugbank" ; rdfs:subClassOf obo:MI_2054 . obo:MI_2003 obo:IAO_0000115 "Standard name of drug or any reagent as provided by its manufacturer." ; oboInOwl:hasExactSynonym "generic name" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2003" ; oboInOwl:inSubset mi:Drugable ; a owl:Class ; rdfs:label "commercial name" ; rdfs:subClassOf obo:MI_1041 . obo:MI_2004 obo:IAO_0000115 "Alternate names of the drug, brand names from different manufacturers." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2004" ; oboInOwl:inSubset mi:Drugable ; a owl:Class ; rdfs:label "drug brand name" ; rdfs:subClassOf obo:MI_1041 . obo:MI_2005 obo:IAO_0000115 "Brand names and composition of mixtures that include the drug described in this DrugCard file." ; oboInOwl:hasExactSynonym "mix brand name" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2005" ; oboInOwl:inSubset mi:Drugable ; a owl:Class ; rdfs:label "drug mixture brand name" ; rdfs:subClassOf obo:MI_1041 . obo:MI_2006 obo:IAO_0000115 "Description of the drug (for biotech drugs) describing its composition and/or preparation." ; oboInOwl:hasExactSynonym "biotech prep" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2006" ; oboInOwl:inSubset mi:Drugable ; a owl:Class ; rdfs:label "biotech product preparation" ; rdfs:subClassOf obo:MI_2089 . obo:MI_2007 obo:IAO_0000115 "IUPAC or standard chemical name for a drug, or a chemical." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2007" ; oboInOwl:inSubset mi:Drugable ; a owl:Class ; rdfs:label "iupac name" ; rdfs:subClassOf obo:MI_1041 . obo:MI_2008 obo:IAO_0000115 "Chemical formula describing atomic or elemental composition" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2008" ; oboInOwl:inSubset mi:Drugable ; a owl:Class ; rdfs:label "chemical formula" ; rdfs:subClassOf obo:MI_2086 . obo:MI_2009 obo:IAO_0000115 "Image of the drug structure (if small molecule) or its sequence (if biotech drug)" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2009" ; oboInOwl:inSubset mi:Drugable ; a owl:Class ; rdfs:label "chemical structure" ; rdfs:subClassOf obo:MI_2086 . obo:MI_2010 obo:IAO_0000115 "IUPAC International Chemical Identifier (InChI) - a machine-readable character string describing a chemical structure, developed by IUPAC and the InChI Trust as a standard to allow interoperability and linking between chemical resources. The standard InChI differs from the non-standard InChI in that it is generated with a fixed set of parameters, ensuring consistency between different resources. The current version of the standard InChI software is 1.03." ; oboInOwl:hasExactSynonym "standard inchi" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:hasRelatedSynonym "inchi id" ; oboInOwl:id "MI:2010" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "standard inchi" ; rdfs:subClassOf obo:MI_1212, obo:MI_2091 . obo:MI_2011 obo:IAO_0000115 "Chemical Abstract Service identification number" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2011" ; oboInOwl:inSubset mi:Drugable ; a owl:Class ; rdfs:label "cas registry number" ; rdfs:subClassOf obo:MI_2054 . obo:MI_2012 obo:IAO_0000115 "Kyoto Encyclopedia of Genes and Genomes compound identification number (if molecule is in KEGG)" ; oboInOwl:hasExactSynonym "KEGG Compound ID" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2012" ; oboInOwl:inSubset mi:Drugable ; a owl:Class ; rdfs:label "kegg compound" ; rdfs:subClassOf obo:MI_0470 . obo:MI_2013 obo:IAO_0000115 """NCBI's PubChem database identification number (if molecule is in PubChem). OBSOLETE as redudant with MI:0730""" ; oboInOwl:hasExactSynonym "PubChem ID" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2013" ; oboInOwl:inSubset mi:Drugable ; a owl:Class ; rdfs:label "pubchem" ; owl:deprecated true . obo:MI_2015 obo:IAO_0000115 "Pharmacogenomics Knowledge Base identification number (if molecule is in PharmGKB)" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2015" ; oboInOwl:inSubset mi:Drugable ; a owl:Class ; rdfs:label "pharmgkb" ; rdfs:subClassOf obo:MI_2054 . obo:MI_2016 obo:IAO_0000115 "BIND database Small Molecule Identification number (if molecule is in BIND)" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2016" ; oboInOwl:inSubset mi:Drugable ; a owl:Class ; rdfs:comment "May not be publicly available any more since now owned by Thompson Scientific." ; rdfs:label "bind smid" ; rdfs:subClassOf obo:MI_2054 . obo:MI_2017 obo:IAO_0000115 """The HET records are used to describe non-standard residues, such as prosthetic groups, inhibitors, solvent molecules, and ions for which coordinates are supplied. Groups are considered HET if they are: - not one of the standard amino acids, and - not one of the nucleic acids (C, G, A, T, U, and I), and - not one of the modified versions of nucleic acids (+C, +G, +A, +T, +U, and +I), and - not an unknown amino acid or nucleic acid where UNK is used to indicate the unknown residue name. Het records also describe heterogens for which the chemical identity is unknown, in which case the group is assigned the hetID UNK.""" ; oboInOwl:hasExactSynonym "het" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2017" ; oboInOwl:inSubset mi:Drugable ; a owl:Class ; rdfs:label "heterogen" ; rdfs:subClassOf obo:MI_0460, obo:MI_0472, obo:MI_0806 . obo:MI_2020 obo:IAO_0000115 "Drug Identification Number (Canadian Drug ID system)" ; oboInOwl:hasExactSynonym "din" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2020" ; oboInOwl:inSubset mi:Drugable ; a owl:Class ; rdfs:label "canadian drug identification number" ; rdfs:subClassOf obo:MI_2054 . obo:MI_2021 obo:IAO_0000115 "Hyperlink to RxList entry for the given drug (if it exists)" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2021" ; oboInOwl:inSubset mi:Drugable ; a owl:Class ; rdfs:label "rxlist link" ; rdfs:subClassOf obo:MI_2054 . obo:MI_2023 obo:IAO_0000115 "Material Safety Data Sheet (if it exists). A Material Safety Data Sheet (MSDS) is designed to provide both workers and emergency personnel with the proper procedures for handling or working with a particular substance. MSDS's include information such as physical data (melting point, boiling point, flash point etc.), toxicity, health effects, first aid, reactivity, storage, disposal, protective equipment, andspill/leak procedures. These are of particular use if a spill or other accident occurs." ; oboInOwl:hasExactSynonym "MSDS Material Safety Sheet", "msds" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2023" ; oboInOwl:inSubset mi:Drugable ; a owl:Class ; rdfs:label "material safety data sheet" ; rdfs:subClassOf obo:MI_2086 . obo:MI_2024 obo:IAO_0000115 "number of the patent describing a drug's synthesis or use." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2024" ; oboInOwl:inSubset mi:Drugable ; a owl:Class ; rdfs:label "patent number" ; rdfs:subClassOf obo:MI_0353 . obo:MI_2025 obo:IAO_0000115 "Molecular weight in g/mol, determined from molecular formula or sequence." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2025" ; oboInOwl:inSubset mi:Drugable ; a owl:Class ; rdfs:label "molecular weight" ; rdfs:subClassOf obo:MI_0640 . obo:MI_2026 obo:IAO_0000115 "The melting point of a solid is the temperature range at which it changes state from solid to liquid." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2026" ; oboInOwl:inSubset mi:Drugable ; a owl:Class ; rdfs:label "melting point" ; rdfs:subClassOf obo:MI_0640 . obo:MI_2027 obo:IAO_0000115 "Water solubility in mg/mL or g/L" ; oboInOwl:hasExactSynonym "logSw" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2027" ; oboInOwl:inSubset mi:Drugable ; a owl:Class ; rdfs:label "water solubility" ; rdfs:subClassOf obo:MI_2160 . obo:MI_2029 obo:IAO_0000115 "Water/octanol partition coefficient of a small molecule." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2029" ; oboInOwl:inSubset mi:Drugable ; a owl:Class ; rdfs:label "logp" ; rdfs:subClassOf obo:MI_0640 . obo:MI_2030 obo:IAO_0000115 "The isoelectric point (pI) is the pH at which a particular molecule or surface carries no net electrical charge. For an amino acid with only one amine and one carboxyl group, the pI can be calculated from the pKas of this molecule." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2030" ; oboInOwl:inSubset mi:Drugable ; a owl:Class ; rdfs:label "isoelectric point" ; rdfs:subClassOf obo:MI_0640 . obo:MI_2033 obo:IAO_0000115 "Physical property of a molecule (known as a hydrophobe) that is repelled from a mass of water. Gravy score." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2033" ; oboInOwl:inSubset mi:Drugable ; a owl:Class ; rdfs:label "hydrophobicity" ; rdfs:subClassOf obo:MI_0640 . obo:MI_2036 obo:IAO_0000115 "The boiling point of a liquid is the temperature at which the vapor pressure of the liquid equals the environmental pressure surrounding the liquid. A liquid in a vacuum environment has a lower boiling point than when the liquid is at atmospheric pressure. A liquid in a high pressure environment has a higher boiling point than when the liquid is at atmospheric pressure. In other words, the boiling point of liquids varies with and depends upon the surrounding environmental pressure." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2036" ; oboInOwl:inSubset mi:Drugable ; a owl:Class ; rdfs:label "boiling point" ; rdfs:subClassOf obo:MI_0640 . obo:MI_2039 obo:IAO_0000115 "SMILES string corresponding to drug structure" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2039" ; oboInOwl:inSubset mi:Drugable ; a owl:Class ; rdfs:label "smiles string" ; rdfs:subClassOf obo:MI_1212, obo:MI_2091 . obo:MI_2040 obo:IAO_0000115 "Type of drug (approved, experimental, biotech, nutraceutical)" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2040" ; oboInOwl:inSubset mi:Drugable ; a owl:Class ; rdfs:label "drug type" ; rdfs:subClassOf obo:MI_2089 . obo:MI_2041 obo:IAO_0000115 "Therapeutic category or general category of drug (anti-convulsant, antibacterial, etc.)." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2041" ; oboInOwl:inSubset mi:Drugable ; a owl:Class ; rdfs:label "drug category" ; rdfs:subClassOf obo:MI_2089 . obo:MI_2042 obo:IAO_0000115 "Description or common names of diseases that the drug is used to treat." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2042" ; oboInOwl:inSubset mi:Drugable ; a owl:Class ; rdfs:comment "Source of further terms could be MeSH term or SNOWMAN." ; rdfs:label "disease indication" ; rdfs:subClassOf obo:MI_2089 . obo:MI_2043 obo:IAO_0000115 "Text description of how the drug works at a clinical or physiological level." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2043" ; oboInOwl:inSubset mi:Drugable ; a owl:Class ; rdfs:label "pharmacology" ; rdfs:subClassOf obo:MI_2089 . obo:MI_2044 obo:IAO_0000115 "Description of how the drug works or what it binds to at a molecular level." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2044" ; oboInOwl:inSubset mi:Drugable ; a owl:Class ; rdfs:label "mechanism of action" ; rdfs:subClassOf obo:MI_2089 . obo:MI_2045 obo:IAO_0000115 "Determination of how quickly and how much of a drug reaches its intended target (site) of action." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2045" ; oboInOwl:inSubset mi:Drugable ; a owl:Class ; rdfs:label "drug absorption" ; rdfs:subClassOf obo:MI_0640 . obo:MI_2046 obo:IAO_0000115 "The LD50 is the dose that kills half (50%) of the animals tested" ; oboInOwl:hasExactSynonym "ld50", "lethal dose 50 %" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2046" ; oboInOwl:inSubset mi:Drugable ; a owl:Class ; rdfs:label "lethal dose 50" ; rdfs:subClassOf obo:MI_0640 . obo:MI_2047 obo:IAO_0000115 "Percentage of the drug that is bound in plasma proteins" ; oboInOwl:hasExactSynonym "plasma prot binding", "protein binding %" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2047" ; oboInOwl:inSubset mi:Drugable ; a owl:Class ; rdfs:label "percentage of plasma protein binding" ; rdfs:subClassOf obo:MI_0640 . obo:MI_2048 obo:IAO_0000115 "The chemical conversion of drugs to other compounds in the body, excluding degradation due to any inherent chemical instability of drugs in biological media." ; oboInOwl:hasExactSynonym "drug metabolism" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2048" ; oboInOwl:inSubset mi:Drugable ; a owl:Class ; rdfs:label "drug biotransformation" ; rdfs:subClassOf obo:MI_2115 . obo:MI_2049 obo:IAO_0000115 "Rate The time it takes for the body to eliminate or breakdown half of a dose of a pharmacologic agent, in practice the time taken for plasma concentration to reduce by 50%." ; oboInOwl:hasExactSynonym "distribution halflife", "elimin half life", "t1/2" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2049" ; oboInOwl:inSubset mi:Drugable ; a owl:Class ; rdfs:label "elimination half life" ; rdfs:subClassOf obo:MI_0640 . obo:MI_2050 obo:IAO_0000115 "How the drug is dispensed (tablets, capsules, solutions), packing material." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2050" ; oboInOwl:inSubset mi:Drugable ; a owl:Class ; rdfs:label "dosage form" ; rdfs:subClassOf obo:MI_2089 . obo:MI_2051 obo:IAO_0000115 "Information on the disease indications and treatment regime for the drug. May also include contra-indications." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2051" ; oboInOwl:inSubset mi:Drugable ; a owl:Class ; rdfs:label "patient information" ; rdfs:subClassOf obo:MI_2089 . obo:MI_2053 obo:IAO_0000115 "Cautions or conditions indicating why or when the drug should not be taken or prescribed." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2053" ; oboInOwl:inSubset mi:Drugable ; a owl:Class ; rdfs:label "contraindications" ; rdfs:subClassOf obo:MI_2089 . obo:MI_2054 obo:IAO_0000115 "General on-line reference to other details about a drug or other bioactive entity." ; oboInOwl:hasExactSynonym "bioactive entity ref" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2054" ; oboInOwl:inSubset mi:Drugable, mi:PSI-MI_slim ; a owl:Class ; rdfs:label "bioactive entity reference" ; rdfs:subClassOf obo:MI_0473 . obo:MI_2055 obo:IAO_0000115 "chemical stability occurs when a substance is in a (dynamic) chemical equilibrium with its environment. In this well-defined state, the substance is expected to persist indefinitely (assuming that the environment does not change). A substance which is not chemically stable (yet exists) is metastable or kinetically persistent." ; oboInOwl:hasExactSynonym "thermodynamic stability" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2055" ; oboInOwl:inSubset mi:Drugable ; a owl:Class ; rdfs:label "chemical stability" ; rdfs:subClassOf obo:MI_2086 . obo:MI_2064 obo:IAO_0000115 "Potential ability of a substance to dissolve in a liquid." ; oboInOwl:hasExactSynonym "dt theoretical pi" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2064" ; oboInOwl:inSubset mi:Drugable ; a owl:Class ; rdfs:label "solubility" ; rdfs:subClassOf obo:MI_0640 . obo:MI_2084 obo:IAO_0000115 "Names of organisms which are affected, positively or negatively, by the drug." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2084" ; oboInOwl:inSubset mi:Drugable ; a owl:Class ; rdfs:label "organisms affected" ; rdfs:subClassOf obo:MI_2089 . obo:MI_2086 obo:IAO_0000115 "Chemical and physical properties of a molecule." ; oboInOwl:hasExactSynonym "physicochemical att" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2086" ; oboInOwl:inSubset mi:Drugable ; a owl:Class ; rdfs:label "physicochemical attribute name" ; rdfs:subClassOf obo:MI_0590 . obo:MI_2089 obo:IAO_0000115 "Properties of a chemical tested or used as a drug, herbicide, insecticide etc." ; oboInOwl:hasExactSynonym "bioactive entity att" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2089" ; oboInOwl:inSubset mi:Drugable ; a owl:Class ; rdfs:label "bioactive entity attribute name" ; rdfs:subClassOf obo:MI_0590 . obo:MI_2091 obo:IAO_0000115 "Human artefact to describe and report the structure of a molecule." ; oboInOwl:hasExactSynonym "struc representation" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2091" ; oboInOwl:inSubset mi:Drugable ; a owl:Class ; rdfs:label "structure representation attribute name" ; rdfs:subClassOf obo:MI_0590 . obo:MI_2097 obo:IAO_0000115 "Therapeutic category or general category of drug -anti-convulsant" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2097" ; oboInOwl:inSubset mi:Drugable ; a owl:Class ; rdfs:label "anti-convulsant" ; rdfs:subClassOf obo:MI_2041 . obo:MI_2098 obo:IAO_0000115 "Therapeutic category or general category of drug -anti-bacterial" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2098" ; oboInOwl:inSubset mi:Drugable ; a owl:Class ; rdfs:label "anti-bacterial" ; rdfs:subClassOf obo:MI_2041 . obo:MI_2099 obo:IAO_0000115 "A drug licensed for sale in the USA by the FDA." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2099" ; oboInOwl:inSubset mi:Drugable ; a owl:Class ; rdfs:label "fda approved drug" ; rdfs:subClassOf obo:MI_2040 . obo:MI_2100 obo:IAO_0000115 "A drug which has yet to be formally approved for the indication which it is currently being used to treat." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2100" ; oboInOwl:inSubset mi:Drugable ; a owl:Class ; rdfs:label "experimental drug" ; rdfs:subClassOf obo:MI_2040 . obo:MI_2101 obo:IAO_0000115 "A natural product, such as a protein or peptide, which is produced used biotechnology as a drug." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2101" ; oboInOwl:inSubset mi:Drugable ; a owl:Class ; rdfs:label "biotech drug" ; rdfs:subClassOf obo:MI_2040 . obo:MI_2102 obo:IAO_0000115 "A drug which may also be regarded as a foodstuff." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2102" ; oboInOwl:inSubset mi:Drugable ; a owl:Class ; rdfs:label "nutraceutical drug" ; rdfs:subClassOf obo:MI_2040 . obo:MI_2105 obo:IAO_0000115 "Negative decimal logarithm of Ka, acid dissociation equilibrium constant for the dissociation of a weak acid." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2105" ; oboInOwl:inSubset mi:Drugable ; a owl:Class ; rdfs:comment "Quantitative prediction of this parameter is possible." ; rdfs:label "pka" ; rdfs:subClassOf obo:MI_0640 . obo:MI_2106 obo:IAO_0000115 "The degree of ionization refers to the proportion of neutral particles such as those in a gas or aqueous solution, that are ionized into charged particles. A low degree of ionization is sometimes called partially ionized, and a very high degree of ionization as fully ionized. This measurment is performed at pH 7.4" ; oboInOwl:hasExactSynonym "ionisation ph 7.4" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2106" ; oboInOwl:inSubset mi:Drugable ; a owl:Class ; rdfs:comment "Quantitative prediction of this parameter is possible." ; rdfs:label "degree of ionisation ph 7.4" ; rdfs:subClassOf obo:MI_0640 . obo:MI_2107 obo:IAO_0000115 "The LogD is the ratio of the equilibrium concentrations of all species (unionized and ionized) of a molecule in octanol to same species in the water phase at a given temperature, normally 25 C. It differs from LogP in that ionized species are considered as well as the neutral form of the molecule.pH 7.4" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2107" ; oboInOwl:inSubset mi:Drugable ; a owl:Class ; rdfs:comment "Quantitative prediction of this parameter is possible." ; rdfs:label "logd" ; rdfs:subClassOf obo:MI_0640 . obo:MI_2108 obo:IAO_0000115 "Solubility pH 7.4" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2108" ; oboInOwl:inSubset mi:Drugable ; a owl:Class ; rdfs:comment "Quantitative prediction of this parameter is possible." ; rdfs:label "solubility ph 7.4" ; rdfs:subClassOf obo:MI_2064 . obo:MI_2109 obo:IAO_0000115 "Solubility in DMSO" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2109" ; oboInOwl:inSubset mi:Drugable ; a owl:Class ; rdfs:label "solubility in dmso" ; rdfs:subClassOf obo:MI_2064 . obo:MI_2111 obo:IAO_0000115 "Diffusion coefficient D is proportional to the velocity of the diffusing particles, which depends on the temperature, viscosity of the fluid and the size of the particles according to the Stokes-Einstein relation. In dilute aqueous solutions the diffusion coefficients of most ions are similar and have values that at room temperature are in the range of 0.6x10-9 to 2x10-9 m2/s. For biological molecules the diffusion coefficients normally range from 10-11 to 10-10 m2/s." ; oboInOwl:hasExactSynonym "diffusion coeff" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2111" ; oboInOwl:inSubset mi:Drugable ; a owl:Class ; rdfs:comment "Quantitative prediction of this parameter is possible." ; rdfs:label "diffusion coefficient" ; rdfs:subClassOf obo:MI_0640 . obo:MI_2112 obo:IAO_0000115 "Chemical stability at pH 2" ; oboInOwl:hasExactSynonym "chem stab ph 2" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2112" ; oboInOwl:inSubset mi:Drugable ; a owl:Class ; rdfs:comment "Qualitative prediction of this parameter is possible." ; rdfs:label "chemical stability at pH 2" ; rdfs:subClassOf obo:MI_2055 . obo:MI_2113 obo:IAO_0000115 "The rate of dissolution is a key target for controlling the duration of a drug's effect, and as such, several dosage forms that contain the same active ingredient may be available, differing only in the rate of dissolution. If a drug is supplied in a form that is not readily dissolved, the drug may be released more gradually over time with a longer duration of action. Having a longer duration of action may improve compliance since the medication will not have to be taken as often. Additionally, slow-release dosage forms may maintain concentrations within an acceptable therapeutic range over a long period of time, as opposed to quick-release dosage forms which may result in sharper peaks and troughs in serum concentrations." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2113" ; oboInOwl:inSubset mi:Drugable ; a owl:Class ; rdfs:comment "The prediction of the value for this paramter is currently not possible." ; rdfs:label "dissolution profile" ; rdfs:subClassOf obo:MI_0640 . obo:MI_2115 obo:IAO_0000115 "Determination of the fate of substances administered externally to a living organism i.e. the study of what the body does to a drug." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2115" ; oboInOwl:inSubset mi:Drugable ; a owl:Class ; rdfs:label "pharmacokinetics attribute name" ; rdfs:subClassOf obo:MI_2086 . obo:MI_2116 obo:IAO_0000115 "The permitting or activating of the passage of substances into, out of, or through cells." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2116" ; oboInOwl:inSubset mi:Drugable ; a owl:Class ; rdfs:comment "Quantitative prediction of this parameter is possible." ; rdfs:label "cell permeability" ; rdfs:subClassOf obo:MI_0640 . obo:MI_2118 obo:IAO_0000115 "The Volume of Distribution is the amount of drug in the body divided by the concentration in the blood. Drugs that are highly lipid soluble have a very high volume of distribution (500 litres). Drugs which are lipid insoluble remain in the blood, and have a low Vd." ; oboInOwl:hasExactSynonym "distribution volume", "vd", "vol of distribution" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2118" ; oboInOwl:inSubset mi:Drugable ; a owl:Class ; rdfs:comment "Quantitative prediction of this parameter is possible." ; rdfs:label "volume of distribution" ; rdfs:subClassOf obo:MI_0640 . obo:MI_2120 obo:IAO_0000115 "Accumulation of a drug or chemical substance in various organs (including those not relevant to its pharmacologic or therapeutic action). This distribution depends on the blood flow or perfusion rate of the organ, the ability of the drug to penetrate organ membranes, tissue specificity, protein binding. The distribution is usually expressed as tissue to plasma ratios." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2120" ; oboInOwl:inSubset mi:Drugable ; a owl:Class ; rdfs:comment "Algorithms have been published to predict the value of this parameter but the quality of the prediction is unknown." ; rdfs:label "tissue distribution" ; rdfs:subClassOf obo:MI_0640 . obo:MI_2121 obo:IAO_0000115 "Substrate of a carrier system allowing the intake of an agent into an organ or part of body." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2121" ; oboInOwl:inSubset mi:Drugable ; a owl:Class ; rdfs:comment "The prediction of the value for this parameter is currently not possible." ; rdfs:label "transporter binding" ; rdfs:subClassOf obo:MI_2115 . obo:MI_2122 obo:IAO_0000115 "The ratio of excretion is or measure of the speed at which a constituent is lost from the body." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2122" ; oboInOwl:inSubset mi:Drugable ; a owl:Class ; rdfs:label "clearance" ; rdfs:subClassOf obo:MI_0640 . obo:MI_2123 obo:IAO_0000115 "The renal clearance ratio or fractional excretion is a measure of the speed at which a constituent of urine passes through the kidneys, in this context the rate at which a pharmacological agent is lost from the body via urine." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2123" ; oboInOwl:inSubset mi:Drugable ; a owl:Class ; rdfs:comment "Algorithms have been published to predict the value of this parameter but the quality of the prediction is unknown." ; rdfs:label "renal clearance" ; rdfs:subClassOf obo:MI_0640 . obo:MI_2124 obo:IAO_0000115 "The clearance of a drug is the volume of plasma from which the drug is completely removed per unit time. The amount eliminated is proportional to the concentration of the drug in the blood." ; oboInOwl:hasExactSynonym "cl", "clearance" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2124" ; oboInOwl:inSubset mi:Drugable ; a owl:Class ; rdfs:comment "The prediction of the value for this paramter is currently not possible." ; rdfs:label "total clearance" ; rdfs:subClassOf obo:MI_0640 . obo:MI_2125 obo:IAO_0000115 "The Maximum Absorbable Dose (MAD) represents the amount of drug that can permeate across a barrier." ; oboInOwl:hasExactSynonym "mad" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2125" ; oboInOwl:inSubset mi:Drugable ; a owl:Class ; rdfs:comment "Quantitative prediction of this parameter is possible." ; rdfs:label "maximum absorbable dose" ; rdfs:subClassOf obo:MI_0640 . obo:MI_2126 obo:IAO_0000115 "Water soluble compounds are absorbed in the small intestine mainly via two pathways, the transcellular and the paracellular pathways. The paracellular absorption involves movement of solutes through a restrictive aqueous channel in the tight junctions of adjoining cells by diffusion." ; oboInOwl:hasExactSynonym "paracellular absorp" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2126" ; oboInOwl:inSubset mi:Drugable ; a owl:Class ; rdfs:comment "Quantitative prediction of this parameter is possible." ; rdfs:label "paracellular absorption" ; rdfs:subClassOf obo:MI_0640 . obo:MI_2127 obo:IAO_0000115 "Ratio between the time value at Cmax (maximum concentration) in a dose response curve, and the Cmax value itself." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2127" ; oboInOwl:inSubset mi:Drugable ; a owl:Class ; rdfs:comment "The prediction of the value for this paramter is currently not possible." ; rdfs:label "tmax/cmax" ; rdfs:subClassOf obo:MI_0640 . obo:MI_2128 obo:IAO_0000115 "Substrate for the representitive member of the ABC transprorter family ABCB1 (MDR1, pgy1, P08183). ABC transporters preventing uptake or facilitating clearance of toxic substances, playing an important role in drug excretion through the bile." ; oboInOwl:hasExactSynonym "abcb1 substrate", "pgp(mdr1) substrate " ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2128" ; oboInOwl:inSubset mi:Drugable ; a owl:Class ; rdfs:comment "Algorithms have been published to predict the value of this parameter but the quality of the prediction is unknown." ; rdfs:label "ABCB1 transporter substrate" ; rdfs:subClassOf obo:MI_2121 . obo:MI_2129 obo:IAO_0000115 "Substrate of the bile acid carrier system in both the intestinal tract and the liver. System catalyses of the transfer of bile acid from one side of the membrane to the other. Bile acids are any of a group of steroid carboxylic acids occurring in bile, where they are present as the sodium salts of their amides with glycine or taurine." ; oboInOwl:hasExactSynonym "bile trans substrate" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2129" ; oboInOwl:inSubset mi:Drugable ; a owl:Class ; rdfs:comment "The prediction of the value for this paramater is currently not possible." ; rdfs:label "bile transporter substrate" ; rdfs:subClassOf obo:MI_2121 . obo:MI_2130 obo:IAO_0000115 "Inhibitor of one or more of the family of cytochrome p450 enzymes, probably the most important elements of oxidative metabolism of exogenous compounds." ; oboInOwl:hasExactSynonym "Cytochrome P450 inhibition", "cyp-450 inhibition" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2130" ; oboInOwl:inSubset mi:Drugable ; a owl:Class ; rdfs:comment "Algorithms have been published to predict the value of this parameter but the quality of the prediction is unknown." ; rdfs:label "cyp-450 inhibition" ; rdfs:subClassOf obo:MI_2135 . obo:MI_2131 obo:IAO_0000115 "Identification of the breakdown products of a substance, either through chemical instability or the actions of enzymes within the body" ; oboInOwl:hasExactSynonym "metabolite identific" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2131" ; oboInOwl:inSubset mi:Drugable ; a owl:Class ; rdfs:comment "Algorithms have been published to predict the value of this parameter but the quality of the prediction is unknown." ; rdfs:label "metabolite identification" ; rdfs:subClassOf obo:MI_2115 . obo:MI_2132 obo:IAO_0000115 "Derivative molecule which has formed from a reaction with glutathione." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2132" ; oboInOwl:inSubset mi:Drugable ; a owl:Class ; rdfs:comment "Algorithms have been published to predict the value of this parameter but the quality of the prediction is unknown." ; rdfs:label "gsh adducts" ; rdfs:subClassOf obo:MI_2115 . obo:MI_2133 obo:IAO_0000115 "Neutralization of a compound occuring via its glucuronidation or sulfatation." ; oboInOwl:hasExactSynonym "neutraliz gluc/sulf" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2133" ; oboInOwl:inSubset mi:Drugable ; a owl:Class ; rdfs:comment "Quantitative prediction of this parameter is possible." ; rdfs:label "neutralization by glucuronidation or sulfatation" ; rdfs:subClassOf obo:MI_2048 . obo:MI_2135 obo:IAO_0000115 "The mechanism by which a substance can harm humans or animals." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2135" ; oboInOwl:inSubset mi:Drugable ; a owl:Class ; rdfs:label "toxicity attribute name" ; rdfs:subClassOf obo:MI_2089 . obo:MI_2136 obo:IAO_0000115 "Binds to the hERG (human Ether-a-go-go Related Gene) (Q12809) which encodes the Kv11.1 potassium ion channel responsible for the repolarizing IKr current in the cardiac action potential." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2136" ; oboInOwl:inSubset mi:Drugable ; a owl:Class ; rdfs:comment "Algorithms have been published to predict the value of this parameter but the quality of the prediction is unknown." ; rdfs:label "herg binding" ; rdfs:subClassOf obo:MI_2135 . obo:MI_2137 obo:IAO_0000115 "Tendency of a bioactive entity to induce damage at the level of the gene." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2137" ; oboInOwl:inSubset mi:Drugable ; a owl:Class ; rdfs:comment "Algorithms have been published to predict the value of this parameter but the quality of the prediction is unknown." ; rdfs:label "genotoxicity" ; rdfs:subClassOf obo:MI_2135 . obo:MI_2138 obo:IAO_0000115 "Tendency of a bioactive entity to induce genetic mutations at the nucleotide level e.g. substitution of nucleotide base-pairs and insertions and deletions of one or more nucleotides in DNA sequences." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2138" ; oboInOwl:inSubset mi:Drugable ; a owl:Class ; rdfs:comment "Algorithms have been published to predict the value of this parameter but the quality of the prediction is unknown." ; rdfs:label "mutagenicity" ; rdfs:subClassOf obo:MI_2135 . obo:MI_2139 obo:IAO_0000115 "Tendency of a bioactive entity to induce a cancer." ; oboInOwl:hasExactSynonym "cancerogenicity" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2139" ; oboInOwl:inSubset mi:Drugable ; a owl:Class ; rdfs:comment "Algorithms have been published to predict the value of this parameter but the quality of the prediction is unknown." ; rdfs:label "carcinogenicity" ; rdfs:subClassOf obo:MI_2135 . obo:MI_2140 obo:IAO_0000115 "Tendency of a bioactive entity to induce damage at the level of the chromosome e.g. induce a change in chromosome structure and number." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2140" ; oboInOwl:inSubset mi:Drugable ; a owl:Class ; rdfs:comment "Algorithms have been published to predict the value of this parameter but the quality of the prediction is unknown." ; rdfs:label "chromosome damage" ; rdfs:subClassOf obo:MI_2135 . obo:MI_2141 obo:IAO_0000115 "Tendency of a bioactive entity to affect liver function." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2141" ; oboInOwl:inSubset mi:Drugable ; a owl:Class ; rdfs:comment "Algorithms have been published to predict the value of this parameter but the quality of the prediction is unknown." ; rdfs:label "hepatotoxicity" ; rdfs:subClassOf obo:MI_2135 . obo:MI_2142 obo:IAO_0000115 "Causes excess phospholipids to accumulate within cells." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2142" ; oboInOwl:inSubset mi:Drugable ; a owl:Class ; rdfs:comment "Algorithms have been published to predict the value of this parameter but the quality of the prediction is unknown." ; rdfs:label "phospholipidosis" ; rdfs:subClassOf obo:MI_2135 . obo:MI_2145 obo:IAO_0000115 "Solubility pH 6.5." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2145" ; oboInOwl:inSubset mi:Drugable ; a owl:Class ; rdfs:comment "Quantitative prediction of this parameter is possible." ; rdfs:label "solubility ph 6.5" ; rdfs:subClassOf obo:MI_2064 . obo:MI_2146 obo:IAO_0000115 "Solubility pH 2.0" ; oboInOwl:hasExactSynonym "solubility ph2.0" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2146" ; oboInOwl:inSubset mi:Drugable ; a owl:Class ; rdfs:comment "Quantitative prediction of this parameter is possible." ; rdfs:label "solubility ph 2.0" ; rdfs:subClassOf obo:MI_2064 . obo:MI_2147 obo:IAO_0000115 "Chemical stabilityat at pH 7.4" ; oboInOwl:hasExactSynonym "chem stab ph 7.4" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2147" ; oboInOwl:inSubset mi:Drugable ; a owl:Class ; rdfs:comment "Qualitative prediction of this parameter is possible." ; rdfs:label "chemical stability at pH 7.4" ; rdfs:subClassOf obo:MI_2055 . obo:MI_2148 obo:IAO_0000115 "A drug currently under clinical development." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2148" ; oboInOwl:inSubset mi:Drugable ; a owl:Class ; rdfs:comment "Intact." ; rdfs:label "investigational drug" ; rdfs:subClassOf obo:MI_2040 . obo:MI_2149 obo:IAO_0000115 "A drug for which the licencing for prescriptive use has been withdrawn." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2149" ; oboInOwl:inSubset mi:Drugable ; a owl:Class ; rdfs:comment "Intact." ; rdfs:label "withdrawn drug" ; rdfs:subClassOf obo:MI_2040 . obo:MI_2150 obo:IAO_0000115 "A drug which has not been approved for sale, a drug taken for recreational purposes or a licensed drug sold without a prescription." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2150" ; oboInOwl:inSubset mi:Drugable ; a owl:Class ; rdfs:label "illicit drug" ; rdfs:subClassOf obo:MI_2040 . obo:MI_2151 obo:IAO_0000115 "Effect of additional drug treatments on a given drug action." ; oboInOwl:hasExactSynonym "drug interaction" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2151" ; oboInOwl:inSubset mi:Drugable ; a owl:Class ; rdfs:label "other drug interaction" ; rdfs:subClassOf obo:MI_2089 . obo:MI_2152 obo:IAO_0000115 "Effect of food ingestion on a given drug treatment." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2152" ; oboInOwl:inSubset mi:Drugable ; a owl:Class ; rdfs:comment "IntAct MeSH term or SNOWMAN." ; rdfs:label "food interaction" ; rdfs:subClassOf obo:MI_2089 . obo:MI_2153 obo:IAO_0000115 "Hyperlink to PDRhealth entry for the given drug (if it exists)" ; oboInOwl:hasExactSynonym "PDRhealth" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2153" ; oboInOwl:inSubset mi:Drugable ; a owl:Class ; rdfs:label "pdr health" ; rdfs:subClassOf obo:MI_2054 . obo:MI_2154 obo:IAO_0000115 "Hyperlink to wikipedia entry for the given drug (if it exists)" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2154" ; oboInOwl:inSubset mi:Drugable ; a owl:Class ; rdfs:label "wikipedia" ; rdfs:subClassOf obo:MI_2054 . obo:MI_2155 obo:IAO_0000115 "Molecular weight in g/mol, determined from molecular formula or sequence." ; oboInOwl:hasExactSynonym "avrg mol weight" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2155" ; oboInOwl:inSubset mi:Drugable ; a owl:Class ; rdfs:label "average molecular weight" ; rdfs:subClassOf obo:MI_2025 . obo:MI_2156 obo:IAO_0000115 "Molecular weight in g/mol, determined from molecular formula or sequence." ; oboInOwl:hasExactSynonym "monoisotopic mol wgt" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2156" ; oboInOwl:inSubset mi:Drugable ; a owl:Class ; rdfs:label "monoisotopic molecular weight" ; rdfs:subClassOf obo:MI_2025 . obo:MI_2157 obo:IAO_0000115 "Water solubility in mg/mL or g/L." ; oboInOwl:hasExactSynonym "exp h2o solubilty", "experimental h2o solubility" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2157" ; oboInOwl:inSubset mi:Drugable ; a owl:Class ; rdfs:label "experimental water solubility" ; rdfs:subClassOf obo:MI_2027, obo:MI_2161 . obo:MI_2158 obo:IAO_0000115 "Water solubility in mg/mL or g/L" ; oboInOwl:hasExactSynonym "predicted h2o solub", "predicted h2o solubility" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2158" ; oboInOwl:inSubset mi:Drugable ; a owl:Class ; rdfs:label "predicted water solubility" ; rdfs:subClassOf obo:MI_2027 . obo:MI_2160 obo:IAO_0000115 "Solubility of a molecule in a given solvant." ; oboInOwl:hasExactSynonym "logS" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2160" ; oboInOwl:inSubset mi:Drugable ; a owl:Class ; rdfs:label "logs" ; rdfs:subClassOf obo:MI_0640 . obo:MI_2161 obo:IAO_0000115 "Experimental derived value for the solubility of a molecule in a given solvant." ; oboInOwl:hasExactSynonym "experimental logS" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2161" ; oboInOwl:inSubset mi:Drugable ; a owl:Class ; rdfs:comment "Quantitative prediction of this parameter is possible." ; rdfs:label "experimental logs" ; rdfs:subClassOf obo:MI_2160 . obo:MI_2162 obo:IAO_0000115 "Experimentally derived value for ability of a compound to cross epithelial and endothelial cell barriers Using the CaCo2 cell line derived from a human colorectal adenocarcinoma. Used as an in vitro permeability models to predict human intestinal absorption" ; oboInOwl:hasExactSynonym "caco2 permeability" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2162" ; oboInOwl:inSubset mi:Drugable ; a owl:Class ; rdfs:comment "Quantitative prediction of this parameter is possible." ; rdfs:label "experimental CaCO2 permeability" ; rdfs:subClassOf obo:MI_0640 . obo:MI_2163 obo:IAO_0000115 "Reference assigned to a molecule by sequence homology with another similar sequence." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2163" ; oboInOwl:inSubset mi:Drugable ; a owl:Class ; rdfs:label "by homology" ; rdfs:subClassOf obo:MI_0353 . obo:MI_2164 obo:IAO_0000115 "The Membrane-based Interactome Network Database (MIND) holds a network of over 25,000 putative PPI (PPPI) obtained by screening of over 3,000 unique Arabidopsis ORFs for pair-wise interactions using the yeast mating-based split-ubiquitin system (mbSUS). http://cas-biodb.cas.unt.edu/project/mind/index.php" ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2013-02-26T12:27:35Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2164" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "mind" ; rdfs:subClassOf obo:MI_0461 . obo:MI_2165 obo:IAO_0000115 "The Arabidopsis Interactions Viewer of BAR (the Bio-Array Resource for plant biology) queries a database of 70944 predicted and 28556 confirmed Arabidopsis interacting proteins. The predicted interactions (interologs) were generated by Drs Matt Geisler and Jane Geisler-Lee at the Southern Illinois University. Their current version is Interactome 2.0. The confirmed Arabidopsis interacting proteins come from BIND, the Biomolecular Interaction Network Database, from high-density Arabidopsis protein microarrays, from Braun et al.'s Arabidopsis Interactome 2011 , from Wolf Frommer's Membrane protein INteractome Database MIND, from Etsuko Moryiama's Arabidopsis G-signaling Interactome Database, and over 1190 other literature sources. The interactions in BIND were identified using several different methods, such as yeast two hybrid screens, but also via traditional biochemical methods. http://bar.utoronto.ca/interactions/cgi-bin/arabidopsis_interactions_viewer.cgi\" [PMID:15960624]" ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2013-02-26T12:49:13Z" ; oboInOwl:hasExactSynonym "bar-arabidopsis interactions viewer" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2165" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "bar" ; rdfs:subClassOf obo:MI_0461 . obo:MI_2166 obo:IAO_0000115 """The Arabidopsis Interactome network map is a proteome-wide binary protein-protein interaction map for the interactome network of the plant Arabidopsis thaliana containing ~6,200 highly reliable interactions between ~2,700 proteins. http://interactome.dfci.harvard.edu/A_thaliana/index.php""" ; oboInOwl:created_by "orchard" ; oboInOwl:creation_date "2013-02-26T12:54:32Z" ; oboInOwl:hasExactSynonym "AI" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2166" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "ai" ; rdfs:subClassOf obo:MI_0461 . obo:MI_2167 obo:IAO_0000115 "In the kinetic exclusion assay one of the interaction components (bait) is immobilized to a solid phase (beads) and is used to capture the prey from a solution containing free molecules of both the prey and the bait that has reached kinetic equilibrium. This mixture of free components is only allowed to contact the immobilized bait for a very short time, so bait-prey complexes do not dissociate. The immobilized bait captures a small percentage of the prey, which is proportional to the free prey concentration, and the captured prey is detected usually via a fluorescent tag." ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2015-04-27T15:51:46Z" ; oboInOwl:hasExactSynonym "kinetic exclusion", "kinexa" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2167" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "kinetic exclusion assay" ; rdfs:subClassOf obo:MI_0892 . obo:MI_2168 obo:IAO_0000115 "The interaction is detected through labelling of a specific site -which can be an active site- that is only accessible once the participants are interacting. This conditional site is then marked with a chemical label for detection." ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2015-04-29T10:19:28Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:hasRelatedSynonym "active site labelling" ; oboInOwl:id "MI:2168" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "conditional site labelling" ; rdfs:subClassOf obo:MI_1313 . obo:MI_2169 obo:IAO_0000115 "Techniques based upon the measurement of the emission of one or more photons in a bioluminescent reaction. Such reactions are typically catalyzed by two groups of enzymes: photoproteins and luciferases. Photoproteins emit light in proportion to the concentration of the protein itself, while in a luciferin-luciferase reaction, photon emission is directly proportional to the amount of luciferin." ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2015-04-29T11:50:41Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2169" ; a owl:Class ; rdfs:label "luminiscence technology" ; rdfs:subClassOf obo:MI_0013 . obo:MI_2170 obo:IAO_0000115 "The bimolecular luminescence complementation (BiLC) is an assay for determination of protein interactions and/or their location in living cells. This approach is based on complementation between two fragments of a bioluminescent enzyme such as luciferin or aequorin. Interactions between proteins fused to each fragment bring the fragments together resulting in the reconstitution of a fully functional bioluminescent enzyme that can be identified through microscopy or luminescence detection." ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2015-04-29T12:03:27Z" ; oboInOwl:hasExactSynonym "bilc", "bioluminescence complementation", "bioluminescence complementation assay", "luminescence complementation assay", "luminiscence complementation" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:hasRelatedSynonym "split-luciferase complementation", "split-luciferase complementation assay" ; oboInOwl:id "MI:2170" ; a owl:Class ; rdfs:label "bimolecular luminiscence complementation" ; rdfs:subClassOf obo:MI_2169 . obo:MI_2171 obo:IAO_0000115 "This technology is based on quantifying the BRET between a pair of participants bearing complementation tags and a participant tagged with a bioluminescent enzyme or a fluorescent tag. The tags held by the pair of participants are complementary halves of either a fluorescent tag (N- and C- fragments of the Venus fluorescent protein, for example) or a bioluminescent enzyme (N- and C- fragments of Renilla luciferase, for example). Interaction between the pair of participants leads to reconstruction of the bioluminescent enzyme/fluorescent protein, which can then emit/accept photons that are accepted/emitted by the tag in the third participant, generating the signal used to detect the interaction. The signals emitted by the bioluminescent enzyme and the fluorescent tag have different wavelengths, so they can be distinguished." ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2015-04-29T13:25:55Z" ; oboInOwl:hasExactSynonym "bret complementation", "bret complementation assay", "copa-ret" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2171" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "complemented donor-acceptor resonance energy transfer" ; rdfs:subClassOf obo:MI_0051, obo:MI_2169 . obo:MI_2172 obo:IAO_0000115 """AspGD is an organized collection of genetic and molecular biological information about the filamentous fungi of the genus Aspergillus. Among its many species, the genus contains an excellent model organism (A. nidulans, or its teleomorph Emericella nidulans), an important pathogen of the immunocompromised (A. fumigatus), an agriculturally important toxin producer (A. flavus), and two species used in industrial processes (A. niger and A. oryzae). AspGD contains information about genes and proteins of multiple Aspergillus species; descriptions and classifications of their biological roles, molecular functions, and subcellular localizations; gene, protein, and chromosome sequence information; tools for analysis and comparison of sequences; and links to literature information; as well as a multispecies comparative genomics browser tool (Sybil) for exploration of orthology and synteny across multiple sequenced Aspergillus species. www.aspergillusgenome.org/""" ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2015-05-05T14:28:59Z" ; oboInOwl:hasDbXref "id-validation-regexp:", "search-url:" ; oboInOwl:hasExactSynonym "AspGD", "Aspergillus Genome Database", "aspgd" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2172" ; a owl:Class ; rdfs:label "aspgd" ; rdfs:subClassOf obo:MI_0461 . obo:MI_2173 obo:IAO_0000115 """Candida Genome Database is a resource for genomic sequence data and gene and protein information for Candida albicans and related species. CGD is based on the Saccharomyces Genome Database and is funded by the National Institute of Dental & Craniofacial Research at the US National Institutes of Health. www.candidagenome.org/""" ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2015-05-05T14:41:00Z" ; oboInOwl:hasDbXref "id-validation-regexp:", "search-url:" ; oboInOwl:hasExactSynonym "CGD", "Candida Genome Database", "cgd" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2173" ; a owl:Class ; rdfs:label "cgd" ; rdfs:subClassOf obo:MI_0461 . obo:MI_2174 obo:IAO_0000115 """Community annotation portal associated with PortEco (formerly EcoliHub, http://porteco.org/). It aims to generate community-based pages about everything related to non-pathogenic E. coli, its phages, plasmids, and mobile genetic elements. http://ecoliwiki.net/colipedia/""" ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2015-05-05T14:55:06Z" ; oboInOwl:hasDbXref "id-validation-regexp:", "search-url:" ; oboInOwl:hasExactSynonym "EcoliWiki", "ecoliwiki" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2174" ; a owl:Class ; rdfs:label "ecoliwiki" ; rdfs:subClassOf obo:MI_0461 . obo:MI_2175 obo:IAO_0000115 """The GeneDB project is a core part of the Sanger Institute's Pathogen Genomics activities. Its primary goals are: -to provide reliable access to the latest sequence data and annotation/curation for the whole range of organisms sequenced by the Pathogen group. -to develop the website and other tools to aid the community in accessing and obtaining the maximum value from these data. GeneDB currently provides access to more than 40 genomes, at various stages of completion, from early access to partial genomes with automatic annotation through to complete genomes with extensive manual curation. www.genedb.org""" ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2015-05-05T15:04:16Z" ; oboInOwl:hasDbXref "id-validation-regexp:", "search-url:" ; oboInOwl:hasExactSynonym "GeneDB", "genedb" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2175" ; a owl:Class ; rdfs:label "genedb" ; rdfs:subClassOf obo:MI_0461 . obo:MI_2176 obo:IAO_0000115 """Gramene is a curated, open-source, integrated data resource for comparative functional genomics in crops and model plant species. Gramene currently hosts annotated whole genomes in over two dozen plant species and partial assemblies for almost a dozen wild rice species in the Ensembl browser, genetic and physical maps with genes, ESTs and QTLs locations, genetic diversity data sets, structure-function analysis of proteins, plant pathways databases (BioCyc and Plant Reactome platforms), and descriptions of phenotypic traits and mutations. http://www.gramene.org""" ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2015-05-05T15:12:03Z" ; oboInOwl:hasDbXref "id-validation-regexp:", "search-url:" ; oboInOwl:hasExactSynonym "Gramene", "gramene" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2176" ; a owl:Class ; rdfs:label "gramene" ; rdfs:subClassOf obo:MI_0461 . obo:MI_2177 obo:IAO_0000115 """PomBase is a comprehensive database for the fission yeast Schizosaccharomyces pombe, providing structural and functional annotation, literature curation and access to large-scale data sets. www.pombase.org""" ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2015-05-05T15:17:42Z" ; oboInOwl:hasDbXref "id-validation-regexp:", "search-url:" ; oboInOwl:hasExactSynonym "PomBase", "pombase" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2177" ; a owl:Class ; rdfs:label "pombase" ; rdfs:subClassOf obo:MI_0461 . obo:MI_2178 obo:IAO_0000115 "The Arabidopsis Genome Initiative comprises TAIR, TIGR and MIPS." ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2015-05-05T16:12:18Z" ; oboInOwl:hasDbXref "id-validation-regexp:", "search-url:" ; oboInOwl:hasExactSynonym "AGI_LocusCode", "Arabidopsis Genome Initiative", "agi_locuscode" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2178" ; a owl:Class ; rdfs:label "agi_locuscode" ; rdfs:subClassOf obo:MI_0461 . obo:MI_2179 obo:IAO_0000115 "Reference to the corresponding object in another database. It implies the object is part of a cross-referenced entity (usually a complex)." ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2015-05-11T09:59:36Z" ; oboInOwl:hasExactSynonym "part of", "subset" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2179" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "subset" ; rdfs:subClassOf obo:MI_0353 . obo:MI_2180 obo:IAO_0000115 """AgBase is a curated, open-source, Web-accessible resource for functional analysis of agricultural plant and animal gene products. Their long-term goal is to serve the needs of the agricultural research communities by facilitating post-genome biology for agriculture researchers and for those researchers primarily using agricultural species as biomedical models. They use the Gene Ontology for functional annotation. http://www.agbase.msstate.edu/""" ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2015-05-11T10:23:14Z" ; oboInOwl:hasDbXref "search-url:" ; oboInOwl:hasExactSynonym "AgBase", "agbase" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2180" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "agbase" ; rdfs:subClassOf obo:MI_0461 . obo:MI_2181 obo:IAO_0000115 """The Community Assessment of Community Annotation with Ontologies (CACAO) is a project to do large-scale manual community annotation of gene function using the Gene Ontology as a multi-institution student competition. http://gowiki.tamu.edu/wiki/index.php/Category:CACAO""" ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2015-05-11T10:51:57Z" ; oboInOwl:hasDbXref "search-url:" ; oboInOwl:hasExactSynonym "CACAO", "Community Assessment of Community Annotation with Ontologies", "cacao" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2181" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "cacao" ; rdfs:subClassOf obo:MI_0461 . obo:MI_2182 obo:IAO_0000115 """Database dedicated to annotating gene function related to human fetal development using the Gene Ontology for functional annotation. http://bcb.cs.tufts.edu/dflat/""" ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2015-05-11T11:01:34Z" ; oboInOwl:hasExactSynonym "DFLAT", "Developmental FunctionaL Annotation at Tufts", "dflat" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2182" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "dflat" ; rdfs:subClassOf obo:MI_0473 . obo:MI_2183 obo:IAO_0000115 """The GO Consortium coordinated an effort to maximize and optimize GO annotations for a large and representative set of key genomes, known as 'reference genomes'. The Reference Genome Annotation Project aimed to completely annotate twelve reference genomes, producing a resource that may effectively seed automatic annotation efforts of other genomes. This resource represents manual annotation from PAINT curators into the UniProt Protein2GO curation tool. http://www.geneontology.org/GO.refgenome.shtml""" ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2015-05-11T11:10:30Z" ; oboInOwl:hasExactSynonym "GO central", "GO_central", "The Reference Genome Annotation Project", "go_central" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2183" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "go_central" ; rdfs:subClassOf obo:MI_0448 . obo:MI_2184 obo:IAO_0000115 """Collection and Refinement of Physiological Data on Mycobacterium tuberculosis in the form of GO annitations. MTBBASE data has also been rendered as pathway information in Reactome. http://www.ark.in-berlin.de/Site/MTBbase.html http://www.reactome.org/cgi-bin/eventbrowser_st_id?ST_ID=REACT_121237.1""" ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2015-05-11T11:34:15Z" ; oboInOwl:hasExactSynonym "MTBBASE", "mtbbase" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2184" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "mtbbase" ; rdfs:subClassOf obo:MI_0461 . obo:MI_2185 obo:IAO_0000115 """The Parkinson's UK Gene Ontology Project represents a collaboration between University College London and the European Bioinformatics Institute (EBI), funded by Parkinson's UK. This annotation group is a member of the IMEx Consortium. http://www.ucl.ac.uk/functional-gene-annotation/neurological""" ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2015-05-11T11:45:34Z" ; oboInOwl:hasExactSynonym "Parkinson-UCL", "Parkinsons Disease Gene Ontology Initiative", "ParkinsonsUK-UCL", "parkinsonsuk-ucl" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2185" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "parkinsonsuk-ucl" ; rdfs:subClassOf obo:MI_0461 . obo:MI_2186 obo:IAO_0000115 """The Alzheimers-University of Toronto project adds functional annotation to Alzheimer's related gene products using the Gene Ontology. http://www.ims.utoronto.ca/""" ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2015-05-11T13:13:02Z" ; oboInOwl:hasExactSynonym "Alzheimers Project at University of Toronto", "Alzheimers University of Toronto", "Alzheimers_University_of_Toronto", "alut" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2186" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "alut" ; rdfs:subClassOf obo:MI_0461 . obo:MI_2187 obo:IAO_0000115 """The Roslin Institute uses the Gene Ontology to add functional annotation to different gene products. http://www.roslin.ac.uk/""" ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2015-05-11T13:18:36Z" ; oboInOwl:hasExactSynonym "RI", "Roslin Institute", "Roslin_Institute", "ri", "roslin_institute" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2187" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "ri" ; rdfs:subClassOf obo:MI_0461 . obo:MI_2188 obo:IAO_0000115 """Photoactivatable-Ribonucleoside-Enhanced Crosslinking and Immunoprecipitation (PAR-CLIP) is a biochemical method used for identifying the binding sites of cellular RNA-binding proteins (RBPs) and microRNA-containing ribonucleoprotein complexes (miRNPs). The method relies on the incorporation of photoreactive ribonucleoside analogs, such as 4-thiouridine (4-SU) and 6-thioguanosine (6-SG) into nascent RNA transcripts by living cells. Irradiation of the cells by UV light of 365 nm induces efficient crosslinking of photoreactive nucleoside-labeled cellular RNAs to interacting RBPs. Immunoprecipitation of the RBP of interest is followed by isolation of the crosslinked and coimmunoprecipitated RNA. The isolated RNA is converted into a cDNA library and deep sequenced using next-generation sequencing technology. http://en.wikipedia.org/wiki/PAR-CLIP""" ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2015-05-11T15:13:05Z" ; oboInOwl:hasExactSynonym "PAR-CLIP", "Photoactivatable-Ribonucleoside-Enhanced Crosslinking and Immunoprecipitation", "par-clip" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2188" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "par-clip" ; rdfs:subClassOf obo:MI_2191 . obo:MI_2189 obo:IAO_0000115 "Low-affinity interaction detection method designed specifically to detect interactions between extracellular proteins. Recombinant soluble fragments of these proteins are produced in a (generally) mammalian expression cell line and secreted into the medium and produced in two forms: a biotinylated bait which can be captured on a streptavidin-coated solid phase suitable for screening, and a pentamerised enzyme-tagged (beta-lactamase) prey. The bait and prey proteins are presented to each other in a binary fashion to detect direct interactions between them, similar to a conventional ELISA. The pentamerisation of the proteins in the prey is achieved through a peptide sequence from the cartilage oligomeric matrix protein (COMP) and increases the local concentration of the ectodomains thereby providing significant avidity gains to enable even very transient interactions to be detected. By normalising the activities of both the bait and prey to predetermined levels prior to screening, interactions having monomeric half-lives of 0.1 sec can be detected with low false positive rates." ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2015-06-01T15:05:13Z" ; oboInOwl:hasExactSynonym "AVidity-based EXtracellular Interaction Screen", "avexis", "avidity-based extracellular interaction screen" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2189" ; a owl:Class ; rdfs:label "avexis" ; rdfs:subClassOf obo:MI_0892 . obo:MI_2190 obo:IAO_0000115 "Non-protein coding transcripts longer than 200 nucleotides and that can be involved in a number of functions, like transcription, post-translational and epigenetic regulation. Most lncRNAs do not have a known function so far." ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2015-06-02T11:33:27Z" ; oboInOwl:hasExactSynonym "lncRNA", "lncrna", "long non coding RNA", "long non coding ribonucleic acid", "long non-coding RNA" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2190" ; a owl:Class ; rdfs:label "long non-coding ribonucleic acid" ; rdfs:subClassOf obo:MI_0320 . obo:MI_2191 obo:IAO_0000115 """Combination of cross-linking and co-immunoprecipitation aimed to find protein-RNA interactions. The canonical method uses first a cross-linking procedure over a tissue sample or lysate, and the immunoprecipitated with specific antibodies for the protein of interest. Unspecific proteins are digested via proteinase K treatment. RNA can be then identified via Northern blotting or using RT-PCR and then sequencing of the generated cDNA. https://en.wikipedia.org/wiki/CLIP""" ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2015-06-15T10:17:34Z" ; oboInOwl:hasExactSynonym "CLIP", "clip", "cross linking immunoprecipitation", "cross-linking immunoprecipitation" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2191" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "clip" ; rdfs:subClassOf obo:MI_0430 . obo:MI_2192 obo:IAO_0000115 """This method combines UV cross-linking and immunoprecipitation with high-throughput sequencing to identify binding sites of RNA-binding proteins. https://en.wikipedia.org/wiki/HITS-CLIP""" ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2015-06-15T10:44:44Z" ; oboInOwl:hasExactSynonym "CLIP-Seq", "HITS-CLIP", "UV cross-linking immunoprecipitation combined with high-throughput sequencing", "clip-seq" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2192" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "clip-seq" ; rdfs:subClassOf obo:MI_2191 . obo:MI_2193 obo:IAO_0000115 """iCLIP allows for the stringent purification of UV cross-linked protein-RNA complexes, using immunoprecipitation followed by SDS-PAGE and membrane transfer. The radiolabelled protein-RNA complexes are then excised from the membrane, and treated with proteinase to release the RNA. This leaves one or two amino acids at the RNA cross-link site. The RNA is then reverse transcribed using barcoded primers. Because reverse transcription stops prematurely at the cross-link site, iCLIP allows RNA-protein interaction sites to be identified at high resolution. https://en.wikipedia.org/wiki/ICLIP""" ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2015-06-15T11:17:22Z" ; oboInOwl:hasExactSynonym "iCLIP", "iclip", "individual-nucleotide resolution cross-linking and immunoprecipitation" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2193" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "iclip" ; rdfs:subClassOf obo:MI_2191 . obo:MI_2194 obo:IAO_0000115 "Combination of UV cross-linking and affinity purification where the protein of interest bears a tag used for pull-down or immunoprecipitation. As in CLIP, unspecific proteins are digested via proteinase K treatment and RNAs are tagged with oligonucleotide linkers. RNA can be then identified via Northern blotting or using RT-PCR and then sequencing of the generated cDNA." ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2015-06-15T11:26:33Z" ; oboInOwl:hasExactSynonym "CRAC", "crac", "cross-linking and analysis of cDNAs" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2194" ; a owl:Class ; rdfs:label "crac" ; rdfs:subClassOf obo:MI_0430 . obo:MI_2195 obo:IAO_0000115 "This method is a variation of CRAC where after combined cross-linking and affinity purification of protein-RNA complexes, RNA-RNA interactions are specifically detected. Base-paired RNA molecules can be linked together while tagging RNA with oligonucleotides, generating chimeric RNAs that allow identification of RNA-RNA pairs." ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2015-06-15T11:45:38Z" ; oboInOwl:hasExactSynonym "CLASH", "clash", "cross-linking, ligation, and sequencing of hybrids" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2195" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "clash" ; rdfs:subClassOf obo:MI_2194 . obo:MI_2196 obo:IAO_0000115 "A method that monitors ligand binding by measuring the change in frequency of a quartz crystal resonator resulting from the addition or removal of a small mass of a ligand specifically binding at the surface of the resonator." ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2015-07-07T09:46:51Z" ; oboInOwl:hasExactSynonym "QCM", "qcm" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2196" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "quartz crystal microbalance" ; rdfs:subClassOf obo:MI_0968 . obo:MI_2197 obo:IAO_0000115 "An assay that uses molecular probes, such as ions, small molecules or antibodies to monitor interactions between biomolecules under study." ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2015-07-07T10:11:26Z" ; oboInOwl:hasExactSynonym "probe interaction assay" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2197" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "probe interaction assay" ; rdfs:subClassOf obo:MI_0401 . obo:MI_2198 obo:IAO_0000115 "The interaction is inferred from the effect it exerts on specific chemical labelling of one of the interacting partners." ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2015-07-07T10:14:29Z" ; oboInOwl:hasExactSynonym "labelling assay" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2198" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "labelling assay" ; rdfs:subClassOf obo:MI_2197 . obo:MI_2199 obo:IAO_0000115 "The interaction is detected through selective, chemical blockage of a specific site -which can be an active site- that becomes inaccessible once the participants are interacting. The interaction is detected through loss of signal of the chemical label" ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2015-07-07T11:51:57Z" ; oboInOwl:hasExactSynonym "site-labelling technology", "specific site-labelling technology" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2199" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "specific site-labelling technology" ; rdfs:subClassOf obo:MI_2198 . obo:MI_2200 obo:IAO_0000115 """PRIMESDB is a systems biology platform that is developed to enable the collection, integration and analysis of state-of-the-art genomics, proteomics and mathematical modelling data being generated by the PRIMES project. PRIMES iinvestigates the role of protein interaction machines in oncogenic signalling with a particular focus on the EGFR network. PRIMESDB provides a centralised knowledgebase and analysis platform for cancer protein interaction networks. http://primesdb.eu/""" ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2015-07-13T16:36:21Z" ; oboInOwl:hasExactSynonym "PRIMESDB", "primesdb" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2200" ; a owl:Class ; rdfs:label "primesdb" ; rdfs:subClassOf obo:MI_0461 . obo:MI_2201 obo:IAO_0000115 "Chemical alterations occurring at the nucleotide level in the specific DNA molecule involved in an interaction. The process can involve covalent modifications (i.e. methylations) or other forms of chemical modification." ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2015-08-11T15:37:49Z" ; oboInOwl:hasExactSynonym "DNA chemical modification", "DNA epigenetic modification", "dna chemical modification" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2201" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "DNA chemical modification" ; rdfs:subClassOf obo:MI_0252 . obo:MI_2202 obo:IAO_0000115 "Chemical alterations occurring at the nucleotide level in the specific RNA molecule involved in an interaction. The process can involve covalent modifications (i.e. 2'-O-methylation) or other forms of chemical modification, such as isomerizations (i.e. pseudouridylation)." ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2015-08-11T15:55:40Z" ; oboInOwl:hasExactSynonym "RNA chemical modification", "post-transcriptional modification", "rna chemical modification" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2202" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "RNA chemical modification" ; rdfs:subClassOf obo:MI_0252 . obo:MI_2203 obo:IAO_0000115 "Primer extension can be used to determine the 3' end of a given sequence of RNA. This technique requires a radiolabelled primer which is complementary to a region near the 3' end of the RNA. The primer is allowed to anneal to the RNA and reverse transcriptase is used to synthesize a strand of DNA from the RNA until it reaches the 5' end of the RNA. By denaturing the hybrid and using the extended primer DNA strand as a marker on an electrophoretic gel, it is possible to determine the transcriptional start site." ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2015-08-11T17:22:38Z" ; oboInOwl:hasExactSynonym "primer extension assay" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2203" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "primer extension assay" ; rdfs:subClassOf obo:MI_1193 . obo:MI_2204 obo:IAO_0000115 "A micro RNA (abbreviated miRNA) is a small non-coding RNA molecule (containing about 22 nucleotides) found in plants, animals, and some viruses, which functions in RNA silencing and post-transcriptional regulation of gene expression." ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2016-01-20T16:25:10Z" ; oboInOwl:hasDbXref "url:" ; oboInOwl:hasExactSynonym "miRNA", "micro RNA", "micro-RNA", "micro-rna", "mirna" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2204" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "micro rna" ; rdfs:subClassOf obo:MI_0320 . obo:MI_2205 obo:IAO_0000115 """The PIR-International Protein Sequence Database (PIR-PSD) was the world's first database of classified and functionally annotated protein sequences that grew out of the Atlas of Protein Sequence and Structure (1965-1978) edited by Margaret Dayhoff. Produced and distributed by the Protein Information Resource in collaboration with MIPS (Munich Information Center for Protein Sequences) and JIPID (Japan International Protein Information Database), PIR-PSD has been the most comprehensive and expertly-curated protein sequence database in the public domain for over 20 years. In 2002, PIR joined EBI (European Bioinformatics Institute) and SIB (Swiss Institute of Bioinformatics) to form the UniProt consortium. PIR-PSD sequences and annotations have been integrated into UniProt Knowledgebase. Bi-directional cross-references between UniProt (UniProt Knowledgebase and/or UniParc) and PIR-PSD are established to allow easy tracking of former PIR-PSD entries. PIR-PSD unique sequences, reference citations, and experimentally-verified data can now be found in the relevant UniProt records. Legacy data can be found at http://pir.georgetown.edu/pirwww/dbinfo/pir_psd.shtml""" ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2016-01-20T16:48:10Z" ; oboInOwl:hasExactSynonym "PIR", "Protein Information Resource", "pir" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2205" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "pir" ; rdfs:subClassOf obo:MI_1096 . obo:MI_2206 obo:IAO_0000115 "Chemical modification observed on a nucleic acid molecule in the context of an interaction. Modifications involving full nucleotide substitutions/deletions are excluded from this definition." ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2016-01-21T14:50:29Z" ; oboInOwl:hasExactSynonym "observed na chemical modification", "observed nucleic acid chemical modification" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2206" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "observed nucleic acid chemical modification" ; rdfs:subClassOf obo:MI_0668 . obo:MI_2207 obo:IAO_0000115 "Chemical modification observed on an RNA molecule resulting subsequently of an interaction. Modifications involving full nucleotide substitutions/deletions are excluded from this definition." ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2016-01-21T15:02:23Z" ; oboInOwl:hasExactSynonym "resulting na chemical modification", "resulting nucleic acid chemical modification" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2207" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "resulting nucleic acid chemical modification" ; rdfs:subClassOf obo:MI_2206 . obo:MI_2208 obo:IAO_0000115 "Chemical modification observed on a nucleic acid molecule required for an interaction to occur. Modifications involving full nucleotide substitutions/deletions are excluded from this definition." ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2016-01-21T15:12:35Z" ; oboInOwl:hasExactSynonym "prerequisite-na chemical modification", "prerequisite-nucleic acid chemical modification" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2208" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "prerequisite-nucleic acid chemical modification" ; rdfs:subClassOf obo:MI_2206 . obo:MI_2209 obo:IAO_0000115 "Chemical modification observed on a nucleic acid molecule observed to decrease the strength or rate of an interaction. Modifications involving full nucleotide substitutions/deletions are excluded from this definition." ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2016-01-21T15:17:08Z" ; oboInOwl:hasExactSynonym "na chemical modification decreasing", "nucleic acid chemical modification decreasing an interaction" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2209" ; a owl:Class ; rdfs:label "nucleic acid chemical modification decreasing an interaction" ; rdfs:subClassOf obo:MI_2206 . obo:MI_2210 obo:IAO_0000115 "Chemical modification observed on a nucleic acid molecule observed to disrupt an interaction. Modifications involving full nucleotide substitutions/deletions are excluded from this definition." ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2016-01-21T15:18:52Z" ; oboInOwl:hasExactSynonym "na chemical modification disrupting", "nucleic acid chemical modification disrupting an interaction" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2210" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "nucleic acid chemical modification disrupting an interaction" ; rdfs:subClassOf obo:MI_2206 . obo:MI_2211 obo:IAO_0000115 "Chemical modification observed on a nucleic acid molecule observed to increase the strength or rate of an interaction. Modifications involving full nucleotide substitutions/deletions are excluded from this definition." ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2016-01-21T15:25:51Z" ; oboInOwl:hasExactSynonym "na chemical modification increasing", "nucleic acid chemical modification increasing an interaction" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2211" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "nucleic acid chemical modification increasing an interaction" ; rdfs:subClassOf obo:MI_2206 . obo:MI_2212 obo:IAO_0000115 """The ProteomeXchange consortium was set up to provide a single point of submission of MS proteomics data to the main existing proteomics repositories, and to encourage the data exchange between them for optimal data dissemination. The data is actually hosted by consortium member databases like PeptideAtlas or PRIDE. http://www.proteomexchange.org""" ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2016-02-02T13:52:54Z" ; oboInOwl:hasExactSynonym "ProteomExchange", "proteomexchange" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2212" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "proteomexchange" ; rdfs:subClassOf obo:MI_0737 . obo:MI_2213 obo:IAO_0000115 "Super-resolution microscopy is a form of light microscopy that allows images to be taken with a higher resolution than the diffraction limit. Several different methods can be used to achieve beyond-diffraction limit resolution and these can be broadly divided in two categories: \"true\" super-resolution techniques, which capture information contained in evanescent waves, and \"functional\" super-resolution techniques, which use clever experimental techniques and known limitations on the matter being imaged to reconstruct a super-resolution image." ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2016-02-11T11:10:32Z" ; oboInOwl:hasExactSynonym "super resolution microscopy", "super-resolution microscopy" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2213" ; a owl:Class ; rdfs:label "super-resolution microscopy" ; rdfs:subClassOf obo:MI_0428 . obo:MI_2214 obo:IAO_0000115 "SIGNOR, the SIGnaling Network Open Resource, organizes and stores in a structured format signaling information published in the scientific literature. The captured information is stored as binary causative relationships between biological entities and can be represented graphically as activity flow. The signaling information is mapped to the human proteome even if the experimental evidence is based on experiments on mammalian model organisms." ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2016-03-15T15:31:08Z" ; oboInOwl:hasDbXref "search-url:" ; oboInOwl:hasExactSynonym "SIGNOR", "SIGnaling Network Open Resource", "signaling network open resource", "signor" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2214" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "signor" ; rdfs:subClassOf obo:MI_1106 . obo:MI_2215 obo:IAO_0000115 "This method allows screening of a full matrix of protein pairs in a single multiplexed strain pool. A doubly engineered clone pool is prepared so that each clone bears two distinct DNA barcodes flanked by site specific recombination sequences. Positive bait-prey combinations allow activation of reporter genes and their respective barcodes undergo recombination, creating unique barcode combinations. Recombined barcode tags are then fused, extracted and sequenced for identification of interacting pairs." ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2016-05-05T14:33:32Z" ; oboInOwl:hasExactSynonym "BGF-2h", "barcode fusion genetics two hybrid", "bfg two hybrid", "bfg-2h" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2215" ; a owl:Class ; rdfs:label "barcode fusion genetics two hybrid" ; rdfs:subClassOf obo:MI_1113 . obo:MI_2216 obo:IAO_0000115 """Measurement of de-AMPylation, the removal of a phosphodiester or phosphoramide ester of AMP from Tyr (RESID:AA0203), Lys (RESID:AA0227), Thr (RESID:AA0267), His (RESID:AA0371) and other amino acids.""" ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2016-05-09T09:40:07Z" ; oboInOwl:hasExactSynonym "de-AMPylation assay", "de-ampylation assay", "deAMPylation assay", "deampylation assay" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2216" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "deampylation assay" ; rdfs:subClassOf obo:MI_0415 . obo:MI_2217 obo:IAO_0000115 "The c-terminus of a luciferase protein, fused to a protein of interest for use in the split luciferase complementation assay." ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2016-05-09T09:45:05Z" ; oboInOwl:hasExactSynonym "luciferase-c" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2217" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "luciferase-c" ; rdfs:subClassOf obo:MI_1205 . obo:MI_2218 obo:IAO_0000115 "The n-terminus of a luciferase protein, fused to a protein of interest for use in the split luciferase complementation assay." ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2016-05-09T09:45:23Z" ; oboInOwl:hasExactSynonym "luciferase-n" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2218" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "luciferase-n" ; rdfs:subClassOf obo:MI_1205 . obo:MI_2219 obo:IAO_0000115 "Gaussia luciferase, is an enzyme from the crustacean Gaussia princeps catalyzing the oxidation of coelenterazine to coelenteramide that produces light. Gaussia luciferase produces a blue light around the 480 nm range." ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2016-05-09T10:05:39Z" ; oboInOwl:hasExactSynonym "GLuc tag", "gaussia luciferase", "gaussia luciferase protein tag", "gluc tag" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2219" ; a owl:Class ; rdfs:label "gaussia luciferase protein tag" ; rdfs:subClassOf obo:MI_1205 . obo:MI_2220 obo:IAO_0000115 "The c-terminus of the gaussia luciferase protein, fused to a protein of interest for use in the split luciferase complementation assay." ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2016-05-09T10:13:06Z" ; oboInOwl:hasExactSynonym "gaussia-c" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2220" ; a owl:Class ; rdfs:label "gaussia-c" ; rdfs:subClassOf obo:MI_2219 . obo:MI_2221 obo:IAO_0000115 "The n-terminus of the gaussia luciferase protein, fused to a protein of interest for use in the split luciferase complementation assay." ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2016-05-09T10:13:23Z" ; oboInOwl:hasExactSynonym "gaussia-n" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2221" ; a owl:Class ; rdfs:label "gaussia-n" ; rdfs:subClassOf obo:MI_2219 . obo:MI_2222 obo:IAO_0000115 "Socio-affinity index provides a single measure of the association between each pair of proteins based on an entire AP-MS dataset, considering both the spoke (when one protein retrieves another when tagged) and the matrix (when two proteins are retrieved by another) evidence, and the overall frequency of each protein in the data set." ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2016-05-13T16:16:06Z" ; oboInOwl:hasExactSynonym "inference by socio-affinity scoring", "socio-affinity index inference", "socio-affinity inference", "socioaffinity index scoring", "socioaffinity inference" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2222" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "inference by socio-affinity scoring" ; rdfs:subClassOf obo:MI_0363 . obo:MI_2223 obo:IAO_0000115 "This method measures co-purification of proteins through several orthogonal purification steps, deriving a set of correlation measures that are then computationally weighted and combined to infer interacting pairs." ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2016-05-17T10:36:05Z" ; oboInOwl:hasExactSynonym "inference by quantitative co-purification", "quantitative tagless co - purification" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2223" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "inference by quantitative co-purification" ; rdfs:subClassOf obo:MI_0363 . obo:MI_2224 obo:IAO_0000115 "In this method predicted RNA-RNA pairings are tested by knocking down one of the two interacting RNAs and then experimentally determine if its presence is required for the other to be chemically modified." ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2016-05-23T13:32:07Z" ; oboInOwl:hasExactSynonym "chemical rna modification plus base pairing prediction" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2224" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "chemical rna modification plus base pairing prediction" ; rdfs:subClassOf obo:MI_0254 . obo:MI_2225 obo:IAO_0000115 """ZINC is a database of commercially available compounds for virtual screening. It uses publicly available bioactivity data to allow investigators to access chemical tools for biology. http://zinc15.docking.org/""" ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2016-06-13T15:47:30Z" ; oboInOwl:hasDbXref "id-validation-regexp:", "search-url:" ; oboInOwl:hasExactSynonym "ZINC", "zinc" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2225" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "zinc" ; rdfs:subClassOf obo:MI_0461 . obo:MI_2226 obo:IAO_0000115 "A change in a sequence or structure in comparison to a reference entity due to a insertion, deletion or substitution event that does not have any effect over an interaction when compared with the wild-type." ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2016-06-13T15:57:12Z" ; oboInOwl:hasExactSynonym "mutation not affecting interaction", "mutation with no effect" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2226" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "mutation with no effect" ; rdfs:subClassOf obo:MI_0118 . obo:MI_2227 obo:IAO_0000115 "A change in a sequence or structure in comparison to a reference entity due to a insertion, deletion or substitution event that enables an interaction when compared with the wild-type, which does not interact." ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2016-06-13T16:25:47Z" ; oboInOwl:hasExactSynonym "mutation causing", "mutation causing an interaction", "mutation enabling interaction" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2227" ; a owl:Class ; rdfs:label "mutation causing an interaction" ; rdfs:subClassOf obo:MI_0118 . obo:MI_2228 obo:IAO_0000115 "Interactions and complexes curated by scientists at the Central European Institute of Technology (CEITEC)." ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2016-09-14T10:41:07Z" ; oboInOwl:hasDbXref "search-url:" ; oboInOwl:hasExactSynonym "CEITEC", "Central European Institute of Technology", "ceitec" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2228" ; a owl:Class ; rdfs:label "ceitec" ; rdfs:subClassOf obo:MI_0461 . obo:MI_2229 obo:IAO_0000115 "Interaction between a nucleic acid and a gene region." ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2016-09-21T11:39:49Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2229" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "nucleicacid-gene" ; rdfs:subClassOf obo:MI_1046 . obo:MI_2230 obo:IAO_0000115 "Interaction between a nucleic acid and a corresponding nucleic acid." ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2016-09-21T11:41:03Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2230" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "nucleicacid-nucleicacid" ; rdfs:subClassOf obo:MI_1046 . obo:MI_2231 obo:IAO_0000115 "This approach infers interacting pairs of proteins looking at expression data coming from transcript expression datasets. Co-expressed pairs of genes are ranked and predicted to be interacting proteins as well." ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2016-10-05T11:48:53Z" ; oboInOwl:hasExactSynonym "co-expression", "coexpression", "coexpression prediction" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2231" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "coexpression" ; rdfs:subClassOf obo:MI_0046 . obo:MI_2232 obo:IAO_0000115 "A particular way two or more molecules influence one another." ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2016-12-08T15:17:45Z" ; oboInOwl:hasExactSynonym "molecular association" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2232" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "molecular association" ; rdfs:subClassOf obo:MI_0190 . obo:MI_2233 obo:IAO_0000115 "Binary causative relationships between biological entities. CV terms belonging to this term allow the description of causal interactions using the current PSI-MI schema." ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2017-01-19T13:17:37Z" ; oboInOwl:hasExactSynonym "causal interaction" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2233" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "causal interaction" ; rdfs:subClassOf obo:MI_0000 . obo:MI_2234 obo:IAO_0000115 "The effect of modulator entity A on a modulated entity B." ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2017-01-19T13:20:22Z" ; oboInOwl:hasExactSynonym "causal statement" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2234" ; a owl:Class ; rdfs:label "causal statement" ; rdfs:subClassOf obo:MI_2233 . obo:MI_2235 obo:IAO_0000115 "The effect of a modulator entity A on a modulated entity B that increases the concentration and/or frequency and/or rate and/or extent of the molecular function of B." ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2017-01-19T13:47:54Z" ; oboInOwl:hasExactSynonym "up regulates", "up-regulates" ; oboInOwl:hasNarrowSynonym "activates" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2235" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "up-regulates" ; rdfs:subClassOf obo:MI_2234 . obo:MI_2236 obo:IAO_0000115 "The effect of a modulator entity A on a modulated entity B that increases the frequency, rate or extent of the molecular function of B, an elemental biological activity occurring at the molecular level, such as catalysis or binding (GO:0044093)." ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2017-01-19T13:50:43Z" ; oboInOwl:hasDbXref "GO:GO:0044093" ; oboInOwl:hasExactSynonym "activates activity", "up-regulates activity" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2236" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "up-regulates activity" ; rdfs:subClassOf obo:MI_2235 . obo:MI_2237 obo:IAO_0000115 "The effect of a modulator entity A on a modulated entity B that increases the concentration of the modulated entity B." ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2017-01-19T13:53:41Z" ; oboInOwl:hasExactSynonym "increases quantity", "up-regulates quantity" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2237" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "up-regulates quantity" ; rdfs:subClassOf obo:MI_2235 . obo:MI_2238 obo:IAO_0000115 "The effect of a modulator entity A on a modulated entity B that increases the concentration of the modulated entity B, by promoting its gene expression." ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2017-01-19T13:56:00Z" ; oboInOwl:hasExactSynonym "increases quantity by expression", "up-regulates quantity by expression" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2238" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "up-regulates quantity by expression" ; rdfs:subClassOf obo:MI_2237 . obo:MI_2239 obo:IAO_0000115 "The effect of a modulator entity A on a modulated entity B that increases the concentration of the modulated entity B by preventing its degradation." ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2017-01-19T13:58:03Z" ; oboInOwl:hasExactSynonym "increases quantity by stabilization", "up-regulates quantity by stabilization" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2239" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "up-regulates quantity by stabilization" ; rdfs:subClassOf obo:MI_2237 . obo:MI_2240 obo:IAO_0000115 "The effect of a modulator entity A on a modulated entity B that decreases the concentration and/or frequency and/or ate and/or extent of molecular function of B." ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2017-01-19T14:00:20Z" ; oboInOwl:hasExactSynonym "down regulates", "down-regulates" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2240" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "down-regulates" ; rdfs:subClassOf obo:MI_2234 . obo:MI_2241 obo:IAO_0000115 "The effect of a modulator entity A on a modulated entity B that decreases the frequency, rate or extent of the molecular function of B, an elemental biological activity occurring at the molecular level, such as catalysis or binding (GO:0044093)." ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2017-01-19T14:13:34Z" ; oboInOwl:hasDbXref "GO:GO:0044093" ; oboInOwl:hasExactSynonym "down-regulates activity", "inhibits activity" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2241" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "down-regulates activity" ; rdfs:subClassOf obo:MI_2240 . obo:MI_2242 obo:IAO_0000115 "The effect of a modulator entity A on a modulated entity B that decreases the concentration of the modulated entity B." ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2017-01-19T14:15:10Z" ; oboInOwl:hasExactSynonym "decreases quantity", "down-regulates quantity" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2242" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "down-regulates quantity" ; rdfs:subClassOf obo:MI_2240 . obo:MI_2243 obo:IAO_0000115 "The effect of a modulator entity A on a modulated entity B that decreases the concentration of the modulated entity B, by preventing its gene expression." ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2017-01-19T14:25:28Z" ; oboInOwl:hasExactSynonym "Decrease quantity by repression", "down-regulates quantity by repression" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2243" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "down-regulates quantity by repression" ; rdfs:subClassOf obo:MI_2242 . obo:MI_2244 obo:IAO_0000115 "The effect of a modulator entity A on a modulated entity B that decreases the concentration of the modulated entity B by promoting its degradation." ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2017-01-19T14:28:52Z" ; oboInOwl:hasExactSynonym "decrease quantity by destabilization", "down-regulates quantity by destabilization" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2244" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "down-regulates quantity by destabilization" ; rdfs:subClassOf obo:MI_2242 . obo:MI_2245 obo:IAO_0000115 "Type of relationship between entities involved in a causal interaction. This term is to be used only to describe the effect of a modulator entity A on a modulated entity B when A is not immediately upstream of B." ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2017-01-19T15:44:29Z" ; oboInOwl:hasExactSynonym "causal regulatory mechanism", "indirect causal regulation" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2245" ; a owl:Class ; rdfs:label "causal regulatory mechanism" ; rdfs:subClassOf obo:MI_2233 . obo:MI_2246 obo:IAO_0000115 "The effect of a modulator entity A on a modulated entity B that occurs when A is not immediately upstream of B." ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2017-01-19T15:45:44Z" ; oboInOwl:hasExactSynonym "indirect", "indirect causal regulation" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2246" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "indirect causal regulation" ; owl:deprecated true . obo:MI_2247 obo:IAO_0000115 "Any process that modulates the frequency, rate or extent of the chemical reactions resulting in the transcription of DNA to RNA and gene activity regulation." ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2017-01-19T15:47:39Z" ; oboInOwl:hasExactSynonym "transcriptional regulation" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2247" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "transcriptional regulation" ; rdfs:subClassOf obo:MI_2245 . obo:MI_2248 obo:IAO_0000115 "Any process that modulates the frequency, rate or extent of the chemical reactions and pathways resulting in the formation of proteins by the translation of mRNA." ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2017-01-19T15:48:53Z" ; oboInOwl:hasExactSynonym "translation regulation", "translational regulation" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2248" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "translation regulation" ; rdfs:subClassOf obo:MI_2245 . obo:MI_2249 obo:IAO_0000115 "Any process that control gene expression at the RNA level, between the transcription and the translation of the gene." ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2017-01-19T15:54:32Z" ; oboInOwl:hasExactSynonym "post transcriptional regulation", "post-transcriptional regulation" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2249" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "post transcriptional regulation" ; rdfs:subClassOf obo:MI_2245 . obo:MI_2250 obo:IAO_0000115 "The effect of a modulator entity A on a modulated entity B that occurs when A is immediately upstream of B." ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2017-01-19T15:56:00Z" ; oboInOwl:hasExactSynonym "direct", "direct causal regulation" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2250" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "direct causal regulation" ; owl:deprecated true . obo:MI_2251 obo:IAO_0000115 "Direct binding of a DbTF to a DNA regulatory sequence that modulates the frequency, rate or extent of the chemical reactions resulting in the transcription of DNA to RNA and gene activity regulation." ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2017-01-19T15:57:01Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2251" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "transcriptional regulation by direct binding of dbTF to DNA regulatory element" ; owl:deprecated true . obo:MI_2252 obo:IAO_0000115 "The process mediated by guanine nucleotide exchange factors (GEFs) that catalyze the exchange of bound GDP with cytosolic GTP." ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2017-01-19T16:13:36Z" ; oboInOwl:hasExactSynonym "GEF reaction" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2252" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "guanine nucleotide exchange factor reaction" ; rdfs:subClassOf obo:MI_0414 . obo:MI_2253 obo:IAO_0000115 "A family of cellular proteins able to increases the activity of a GTPase." ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2017-01-19T16:16:04Z" ; oboInOwl:hasExactSynonym "GAP reaction", "GTPase-Accelerating Protein reaction", "RGS protein reaction" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2253" ; a owl:Class ; rdfs:label "gtpase-activating protein reaction" ; owl:deprecated true . obo:MI_2254 obo:IAO_0000115 "The effect of a chemical compound that results in the activation or in an increased activation of a target molecule." ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2017-01-19T16:23:55Z" ; oboInOwl:hasExactSynonym "chemical activation reaction" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2254" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "chemical activation reaction" ; owl:deprecated true . obo:MI_2255 obo:IAO_0000115 "The effect of a chemical compound that stops, prevents, or reduces the activity of a target molecule." ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2017-01-19T16:25:05Z" ; oboInOwl:hasExactSynonym "chemical inhibition reaction" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2255" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "chemical inhibition reaction" ; owl:deprecated true . obo:MI_2256 obo:IAO_0000115 "Any process that modulates the frequency, rate or extent of any process in which a cell, a substance, or a cellular entity is transported to, or maintained in, a specific location." ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2017-01-19T16:26:15Z" ; oboInOwl:hasExactSynonym "relocalization" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2256" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "relocalization" ; owl:deprecated true . obo:MI_2257 obo:IAO_0000115 "The chemical reactions and pathways resulting in the formation, breakdown, modification of small molecules." ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2017-01-19T16:27:34Z" ; oboInOwl:hasExactSynonym "small molecule catalysis reaction" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2257" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "small molecule catalysis reaction" ; owl:deprecated true . obo:MI_2258 obo:IAO_0000115 "Molecule that encompasses any constitutionally or isotopically distinct atom, molecule, ion, ion pair, radical, radical ion, complex, conformer, etc., identifiable as a separately distinguishable entity, which is not physiologically part of a cell, tissue, organ, or organism." ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2017-01-19T16:46:33Z" ; oboInOwl:hasExactSynonym "chemical", "drug", "xenobiotic" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2258" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "xenobiotic" ; rdfs:subClassOf obo:MI_0328 . obo:MI_2259 obo:IAO_0000115 "Entity involved in a causative relationship. These terms have to be used as interactor types only if associated with causal statements." ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2017-01-19T16:51:20Z" ; oboInOwl:hasExactSynonym "causal interactor type" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2259" ; a owl:Class ; rdfs:label "causal interactor type" ; rdfs:subClassOf obo:MI_2233 . obo:MI_2260 obo:IAO_0000115 "Any detectable change in the internal or external environment of a cell, tissue, organ, or organism." ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2017-01-19T16:52:44Z" ; oboInOwl:hasExactSynonym "stimulus" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2260" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "stimulus" ; rdfs:subClassOf obo:MI_2259 . obo:MI_2261 obo:IAO_0000115 "Cellular phenotype is the conglomerate of multiple cellular processes involving gene and protein expression that result in the elaboration of a cell's particular morphology and function." ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2017-01-19T16:54:07Z" ; oboInOwl:hasExactSynonym "phenotype" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2261" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "phenotype" ; rdfs:subClassOf obo:MI_2259 . obo:MI_2262 obo:IAO_0000115 "The modification of a subsequence that regulates the concentration and/or frequency and/or rate and/or extent of the molecular function of an entity." ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2017-01-19T17:03:04Z" ; oboInOwl:hasExactSynonym "causal regulatory modification" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2262" ; a owl:Class ; rdfs:comment "CAUTION: This is a temporary branch. These terms will be soon added in the PSI-MOD ontology and this branch will became obsolete." ; rdfs:label "causal regulatory modification" ; rdfs:subClassOf obo:MI_2233 . obo:MI_2263 obo:IAO_0000115 "Reaction that create a covalent bond between a nitrogen monoxide group and the thiol group of cysteine." ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2017-01-19T17:11:46Z" ; oboInOwl:hasExactSynonym "s-nitrosylation" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2263" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "s-nitrosylation" ; rdfs:subClassOf obo:MI_0414 . obo:MI_2264 obo:IAO_0000115 "A protein modification that effectively add a tyrosine residues to the c-terminal end of alpha-tubulin." ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2017-01-23T10:26:40Z" ; oboInOwl:hasExactSynonym "tyrosinated residue" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2264" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "tyrosinated residue" ; rdfs:subClassOf obo:MI_2262 . obo:MI_2265 obo:IAO_0000115 "A protein modification that effectively remove an acyl group from a protein." ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2017-01-23T10:30:06Z" ; oboInOwl:hasExactSynonym "de-acetylated residue", "deacetylated residue" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2265" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "de-acetylated residue" ; rdfs:subClassOf obo:MI_2262 . obo:MI_2266 obo:IAO_0000115 "A protein modification that effectively remove a phosphate group from a protein by hydrolysis." ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2017-01-23T10:32:50Z" ; oboInOwl:hasExactSynonym "de-phosphorylated residue", "dephosphorylated residue" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2266" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "de-phosphorylated residue" ; rdfs:subClassOf obo:MI_2262 . obo:MI_2267 obo:IAO_0000115 "A protein modification that effectively cleaves the G-K bond and releases SUMO proteins." ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2017-01-23T10:46:01Z" ; oboInOwl:hasExactSynonym "de-sumoylated residue", "desumoylated residue" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2267" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "de-sumoylated residue" ; rdfs:subClassOf obo:MI_2262 . obo:MI_2268 obo:IAO_0000115 "A protein modification that effectively removes one or more methyl groups from a protein." ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2017-01-23T10:47:33Z" ; oboInOwl:hasExactSynonym "de-methylated residue", "demethylated residue" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2268" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "de-methylated residue" ; rdfs:subClassOf obo:MI_2262 . obo:MI_2269 obo:IAO_0000115 "A protein modification that effectively cleaves the G-K bond and releases ubiquitin or ubiquitin like proteins." ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2017-01-23T10:48:53Z" ; oboInOwl:hasExactSynonym "de-ubiquitinylated residue", "deubiquitinylated residue" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2269" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "de-ubiquitinylated residue" ; rdfs:subClassOf obo:MI_2262 . obo:MI_2270 obo:IAO_0000115 """SignaLink 2.0 is a signaling pathway resource with multi-layered regulatory networks. http://signalink.org""" ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2017-01-23T11:41:20Z" ; oboInOwl:hasDbXref "url:http://signalink.org" ; oboInOwl:hasExactSynonym "SignaLink", "signalink" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2270" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "signalink" ; rdfs:subClassOf obo:MI_0461 . obo:MI_2271 obo:IAO_0000115 """EDAM (EMBRACE Data And Methods) is an ontology of bioinformatics operations (tool, application, or workflow functions), types of data, topics (application domains), and data formats. http://edamontology.org/""" ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2017-01-26T15:09:47Z" ; oboInOwl:hasDbXref "url:http://edamontology.org/" ; oboInOwl:hasExactSynonym "EDAM", "EMBRACE Data And Methods", "edam" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2271" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "edam" ; rdfs:subClassOf obo:MI_1336 . obo:MI_2272 obo:IAO_0000115 "Reversible reaction that add a tyrosine residue to an amino-acid." ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2017-01-26T15:21:43Z" ; oboInOwl:hasDbXref "GO:GO:0018322" ; oboInOwl:hasExactSynonym "tyrosinylation" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2272" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "tyrosinylation" ; rdfs:subClassOf obo:MI_0414 . obo:MI_2273 obo:IAO_0000115 "Reversible reaction that add a tyrosine residues to the c-terminal end of alpha-tubulin." ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2017-01-26T15:22:39Z" ; oboInOwl:hasDbXref "GO:GO:0018166" ; oboInOwl:hasExactSynonym "tyrosination" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2273" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "tyrosination" ; rdfs:subClassOf obo:MI_2272 . obo:MI_2274 obo:IAO_0000115 "Entity whose activity exerts an effect on the concentration, frequency, rate or extent of the target entity." ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2017-01-26T15:29:51Z" ; oboInOwl:hasExactSynonym "modulator", "regulator" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2274" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "regulator" ; rdfs:subClassOf obo:MI_0500 . obo:MI_2275 obo:IAO_0000115 "Entity whose concentration, frequency, rate or extent are regulated by the regulator entity." ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2017-01-26T15:31:14Z" ; oboInOwl:hasExactSynonym "modulator target", "regulator target" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2275" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "regulator target" ; rdfs:subClassOf obo:MI_0500 . obo:MI_2276 obo:IAO_0000115 "Chemical alterations occurring in the specific carbohydrate molecule involved in an interaction. The process can involve covalent modifications (i.e. sulfations) or other forms of chemical modification." ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2017-03-06T11:04:25Z" ; oboInOwl:hasExactSynonym "carbohydrate chemical modification" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2276" ; a owl:Class ; rdfs:label "carbohydrate chemical modification" ; rdfs:subClassOf obo:MI_0252 . obo:MI_2277 obo:IAO_0000115 "This method uses Cre recombinase as a two-hybrid protein-protein interaction reporter that functions intracellularly to covalently and unidirectionally link interacting bait and prey plasmids via specialized loxP sites that flank the protein-coding sequences. The linked protein-coding sequences serve as interaction-identifying DNA molecules that enable massively multiplexed screening coupled with next-generation DNA sequencing to detect protein-protein interactions." ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2017-06-20T15:57:41Z" ; oboInOwl:hasExactSynonym "Cre recombinase two hybrid", "cr-2h", "cr-two hybrid" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2277" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "Cr-two hybrid" ; rdfs:subClassOf obo:MI_1113 . obo:MI_2278 obo:IAO_0000115 "Length of a repetitive polymer chain. Applicable to carbohydrates and other non-protein, non-nucleic acid polymers." ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2017-07-05T10:27:19Z" ; oboInOwl:hasExactSynonym "polymer chain length" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2278" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "polymer chain length" ; rdfs:subClassOf obo:MI_0666 . obo:MI_2279 obo:IAO_0000115 "The Complex Portal is a manually curated, encyclopaedic resource of macromolecular complexes from a number of key model organisms, entered into the IntAct molecular interaction database . Data includes protein-only complexes as well as protein-small molecule and protein-nucleic acid complexes. All complexes are derived from physical molecular interaction evidences extracted from the literature and cross-referenced in the entry, or by curator inference from information on homologs in closely related species or by inference from scientific background. All complexes are tagged with Evidence and Conclusion Ontology codes to indicate the type of evidence available for each entry." ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2017-07-28T09:34:45Z" ; oboInOwl:hasDbXref "search-url:" ; oboInOwl:hasExactSynonym "Complex Portal", "complex portal" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2279" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "complex portal" ; rdfs:subClassOf obo:MI_0461, obo:MI_0473 . obo:MI_2280 obo:IAO_0000115 "Reaction in which an amide functional group in the side chain of the amino acids asparagine or glutamine is removed or converted to another functional group. Typically, asparagine is converted to aspartic acid or isoaspartic acid and glutamine is converted to glutamic acid or pyroglutamic acid (5-oxoproline)." ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2017-08-08T14:38:29Z" ; oboInOwl:hasExactSynonym "deamidation" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2280" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "deamidation reaction" ; rdfs:subClassOf obo:MI_0414 . obo:MI_2281 obo:IAO_0000115 "Assay to measure the catalysis of the reaction: a monocarboxylic acid amide + H2O = a monocarboxylate + NH3." ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2017-08-08T14:49:09Z" ; oboInOwl:hasExactSynonym "amidase assay", "deamidation" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2281" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "deamidation assay" ; rdfs:subClassOf obo:MI_0415 . obo:MI_2282 obo:IAO_0000115 "Complex object unique primary identifier that is assigned to a complex in the Complex Portal." ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2017-08-25T13:31:03Z" ; oboInOwl:hasExactSynonym "complex-primary" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2282" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "complex-primary" ; rdfs:subClassOf obo:MI_0353 . obo:MI_2283 obo:IAO_0000115 "Southwestern blotting, is a lab technique which involves identifying and characterizing DNA-binding proteins by their ability to bind to specific oligonucleotide probes, generally radioactively labeled. The proteins are separated by gel electrophoresis and are subsequently transferred to nitrocellulose membranes similar to other types of blotting." ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2017-11-15T15:35:20Z" ; oboInOwl:hasExactSynonym "southwestern blot", "southwestern blotting" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2283" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "southwestern blotting" ; rdfs:subClassOf obo:MI_0047 . obo:MI_2284 obo:IAO_0000115 "Indicates that the cross-referenced molecule is a component of a containing complex." ; oboInOwl:created_by "ppm" ; oboInOwl:creation_date "2017-12-15T11:08:53Z" ; oboInOwl:hasExactSynonym "complex component", "complex-component" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2284" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "complex component" ; rdfs:subClassOf obo:MI_0353 . obo:MI_2285 obo:IAO_0000115 "The method is based on the functional effect of the binding of the microRNA on the target (mRNA or LncRNA), which is the repression of the expression of the target. To validate a sequence as a direct target of a microRNA, a luciferase reporter gene carrying the wt candidate sequence or its mutated form is used, and the expression of the target is evaluated with a luciferase assay. If the wt is significantly less expressed than the mutant, the binding occurs." ; oboInOwl:created_by "pporras" ; oboInOwl:creation_date "2018-05-02T15:22:12Z" ; oboInOwl:hasExactSynonym "miRNA interference luciferase assay" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2285" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "miRNA interference luciferase reporter assay" ; rdfs:subClassOf obo:MI_0255 . obo:MI_2286 obo:IAO_0000115 "Binary relationship between biological entities when one of them modulates the other in terms of function, expression, degradation or stability of the other and the relationship between the partners cannot be ascertained as direct, so intermediate steps are implicitly present. This relation specifically does not imply a physical interaction between the entities involved." ; oboInOwl:created_by "pporras" ; oboInOwl:creation_date "2018-06-27T15:24:40Z" ; oboInOwl:hasExactSynonym "functional association" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2286" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "functional association" ; rdfs:subClassOf obo:MI_0190 . obo:MI_2287 obo:IAO_0000115 """Identity of the participant was established (or confirmed) by fitting its molecular model to the experimentally determined electron density.""" ; oboInOwl:created_by "pporras" ; oboInOwl:creation_date "2018-06-28T15:00:41Z" ; oboInOwl:hasExactSynonym "identification by structure determination", "structure determination" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2287" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "identification by structure determination" ; rdfs:subClassOf obo:MI_0661 . obo:MI_2288 obo:IAO_0000115 "DAP-seq is an in vitro TF-DNA binding assay in which a DAP-seq gDNA library is prepared by attaching a short DNA sequencing adaptor onto purified and fragmented gDNA. In a separate reaction, an affinity-purified TF is prepared by in vitro expression, bound to ligand-coupled beads, and washed to remove non-specific cellular components. The gDNA library is added to the affinity-bound TF and the unbound DNA is washed away. The bound fraction is eluted, amplified with PCR primers to introduce an indexed adaptor, and the DNA is sequenced." ; oboInOwl:created_by "pporras" ; oboInOwl:creation_date "2018-06-28T16:09:45Z" ; oboInOwl:hasExactSynonym "DNA affinity purification sequencing", "dap-seq" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2288" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "DAP-seq" ; rdfs:subClassOf obo:MI_0004 . obo:MI_2289 obo:IAO_0000115 "The bait fused to a viral protein (e.g. HIV-1 GAG protein) allows the trapping of interaction partners (preys) within virus-like particles (VLPs) that bud from mammalian cells. Once the VLPs are enriched and purified, this technique allows the isolation of multimeric complexes as well as binary interactions and their subsequent identification by methods such as MS and western blots." ; oboInOwl:created_by "pporras" ; oboInOwl:creation_date "2018-09-13T10:18:19Z" ; oboInOwl:hasExactSynonym "viral particle co-purification" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2289" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "virotrap" ; rdfs:subClassOf obo:MI_0401 . obo:MI_2290 obo:IAO_0000115 "Optical tweezers are instruments that use a focused laser beam to apply force to particles suspended in a liquid medium. This allows to measure forces generated between interacting molecules - either at the level of just single interacting pair of molecules or at the level of larger molecular assemblies." ; oboInOwl:created_by "pporras" ; oboInOwl:creation_date "2018-09-13T10:39:59Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2290" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "optical tweezers" ; rdfs:subClassOf obo:MI_0859 . obo:MI_2291 obo:IAO_0000115 "Molecules adsorbed on a solid surface are picked up by a microscopic tip (nanometers wide) that is located at the end of an elastic cantilever. Piezoelectric controller is used to measure forces generated by single molecules or molecular complexes stretched between the substrate and the cantilever tip." ; oboInOwl:created_by "pporras" ; oboInOwl:creation_date "2018-09-13T10:49:44Z" ; oboInOwl:hasExactSynonym "afm cantilevers" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2291" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "atomic force microscopy cantilevers" ; rdfs:subClassOf obo:MI_0859 . obo:MI_2292 obo:IAO_0000115 "Magnetic tweezers are instruments that use a set of magnets to apply forces to physically hold and move individual molecules attached to ferromagnetic beads. Such instruments allow to measure the forces generated between interacting molecules - either at the level of just single interacting pair of molecules or at the level of larger molecular assemblies." ; oboInOwl:created_by "pporras" ; oboInOwl:creation_date "2018-09-13T12:04:16Z" ; oboInOwl:hasExactSynonym "electromagnetic tweezers" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2292" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "magnetic tweezers" ; rdfs:subClassOf obo:MI_0859 . obo:MI_2293 obo:IAO_0000115 "Term describing the upstream end of a nucleotide sequence." ; oboInOwl:created_by "pporras" ; oboInOwl:creation_date "2018-09-14T09:15:05Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2293" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "5' position" ; rdfs:subClassOf obo:MI_0333 . obo:MI_2294 obo:IAO_0000115 "Term describing the upstream region of a nucleotide sequence, exact coordinates not available." ; oboInOwl:created_by "pporras" ; oboInOwl:creation_date "2018-09-14T09:25:33Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2294" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "5' range" ; rdfs:subClassOf obo:MI_0333 . obo:MI_2295 obo:IAO_0000115 "Term describing the downstream end of a nucleotide sequence." ; oboInOwl:created_by "pporras" ; oboInOwl:creation_date "2018-09-14T09:26:47Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2295" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "3' position" ; rdfs:subClassOf obo:MI_0333 . obo:MI_2296 obo:IAO_0000115 "Term describing the downstream region of a nucleotide sequence, exact coordinates not available." ; oboInOwl:created_by "pporras" ; oboInOwl:creation_date "2018-09-14T09:27:33Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2296" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "3' range" ; rdfs:subClassOf obo:MI_0333 . obo:MI_2297 obo:IAO_0000115 "Chemical alterations occurring in the specific carbohydrate molecule involved in an interaction that enables an interaction when compared with the unaltered carbohydrate, which does not interact." ; oboInOwl:created_by "pporras" ; oboInOwl:creation_date "2018-09-14T09:45:20Z" ; oboInOwl:hasExactSynonym "carbohydrate chemical modification causing" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2297" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "carbohydrate chemical modification causing an interaction" ; rdfs:subClassOf obo:MI_2276 . obo:MI_2298 obo:IAO_0000115 "Chemical alterations occurring in the specific carbohydrate molecule involved in an interaction that does not have any effect over an interaction when compared with the unaltered form." ; oboInOwl:created_by "pporras" ; oboInOwl:creation_date "2018-09-14T09:49:02Z" ; oboInOwl:hasExactSynonym "carbohydrate chemical modification not affecting interaction" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2298" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "carbohydrate chemical modification with no effect" ; rdfs:subClassOf obo:MI_2276 . obo:MI_2299 obo:IAO_0000115 "Chemical alterations occurring in the specific carbohydrate molecule involved in an interaction that decreases significantly interaction strength or rate (in the case of interactions inferred from enzymatic reaction) when compared with the unaltered carbohydrate." ; oboInOwl:created_by "pporras" ; oboInOwl:creation_date "2018-09-14T09:53:05Z" ; oboInOwl:hasExactSynonym "carbohydrate chemical modification decreasing" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2299" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "carbohydrate chemical modification decreasing interaction" ; rdfs:subClassOf obo:MI_2276 . obo:MI_2300 obo:IAO_0000115 "Chemical alterations occurring in the specific carbohydrate molecule involved in an interaction that decreases significantly interaction rate (in the case of interactions inferred from enzymatic reaction) when compared with the unaltered carbohydrate." ; oboInOwl:created_by "pporras" ; oboInOwl:creation_date "2018-09-14T09:56:38Z" ; oboInOwl:hasExactSynonym "carbohydrate chemical modification decreasing rate" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2300" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "carbohydrate chemical modification decreasing interaction rate" ; rdfs:subClassOf obo:MI_2299 . obo:MI_2301 obo:IAO_0000115 "Chemical alterations occurring in the specific carbohydrate molecule involved in an interaction that decreases significantly interaction strength when compared with the unaltered carbohydrate." ; oboInOwl:created_by "pporras" ; oboInOwl:creation_date "2018-09-14T09:58:21Z" ; oboInOwl:hasExactSynonym "carbohydrate chemical modification decreasing strength" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2301" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "carbohydrate chemical modification decreasing interaction strength" ; rdfs:subClassOf obo:MI_2299 . obo:MI_2302 obo:IAO_0000115 "Chemical alterations occurring in the specific carbohydrate molecule involved in an interaction that disrupts interaction strength or rate (in the case of interactions inferred from enzymatic reaction) when compared with the unaltered carbohydrate." ; oboInOwl:created_by "pporras" ; oboInOwl:creation_date "2018-09-14T10:03:25Z" ; oboInOwl:hasExactSynonym "carbohydrate chemical modification disrupting" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2302" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "carbohydrate chemical modification disrupting interaction" ; rdfs:subClassOf obo:MI_2299 . obo:MI_2303 obo:IAO_0000115 "Chemical alterations occurring in the specific carbohydrate molecule involved in an interaction that disrupts interaction strength when compared with the unaltered carbohydrate." ; oboInOwl:created_by "pporras" ; oboInOwl:creation_date "2018-09-14T10:06:44Z" ; oboInOwl:hasExactSynonym "carbohydrate chemical modification disrupting strength" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2303" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "carbohydrate chemical modification disrupting interaction strength" ; rdfs:subClassOf obo:MI_2302 . obo:MI_2304 obo:IAO_0000115 "Chemical alterations occurring in the specific carbohydrate molecule involved in an interaction that disrupts interaction rate (in the case of interactions inferred from enzymatic reaction) when compared with the unaltered carbohydrate." ; oboInOwl:created_by "pporras" ; oboInOwl:creation_date "2018-09-14T10:08:37Z" ; oboInOwl:hasExactSynonym "carbohydrate chemical modification disrupting rate" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2304" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "carbohydrate chemical modification disrupting interaction rate" ; rdfs:subClassOf obo:MI_2302 . obo:MI_2305 obo:IAO_0000115 "Chemical alterations occurring in the specific carbohydrate molecule involved in an interaction that increases significantly interaction strength or rate (in the case of interactions inferred from enzymatic reaction) when compared with the unaltered carbohydrate." ; oboInOwl:created_by "pporras" ; oboInOwl:creation_date "2018-09-14T10:11:37Z" ; oboInOwl:hasExactSynonym "carbohydrate chemical modification increasing" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2305" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "carbohydrate chemical modification increasing interaction" ; rdfs:subClassOf obo:MI_2276 . obo:MI_2306 obo:IAO_0000115 "Chemical alterations occurring in the specific carbohydrate molecule involved in an interaction that increases significantly interaction strength when compared with the unaltered carbohydrate." ; oboInOwl:created_by "pporras" ; oboInOwl:creation_date "2018-09-14T10:22:03Z" ; oboInOwl:hasExactSynonym "carbohydrate chemical modification increasing strength" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2306" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "carbohydrate chemical modification increasing interaction strength" ; rdfs:subClassOf obo:MI_2305 . obo:MI_2307 obo:IAO_0000115 "Chemical alterations occurring in the specific carbohydrate molecule involved in an interaction that increases significantly interaction rate (in the case of interactions inferred from enzymatic reaction) when compared with the unaltered carbohydrate." ; oboInOwl:created_by "pporras" ; oboInOwl:creation_date "2018-09-14T10:23:21Z" ; oboInOwl:hasExactSynonym "carbohydrate chemical modification increasing rate" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2307" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "carbohydrate chemical modification increasing interaction rate" ; rdfs:subClassOf obo:MI_2305 . obo:MI_2308 obo:IAO_0000115 "Carbohydrate species chemically attached to proteins, or other organic molecules." ; oboInOwl:created_by "pporras" ; oboInOwl:creation_date "2018-09-14T10:26:12Z" ; oboInOwl:hasExactSynonym "attached glycan", "glycosylation" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2308" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:comment "Specific carbohydrate species can be represented through the MOD ontology and their representation escapes the scope of this CV." ; rdfs:label "attached carbohydrate" ; rdfs:subClassOf obo:MI_0252 . obo:MI_2309 obo:IAO_0000115 "Carbohydrate species chemically attached to proteins, or other organic molecules involved in an interaction that enables an interaction when compared with the non-glycosylated molecule, which does not interact." ; oboInOwl:created_by "pporras" ; oboInOwl:creation_date "2018-09-14T10:37:41Z" ; oboInOwl:hasExactSynonym "attached carbohydrate causing", "glycosylation causing interaction" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2309" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "attached carbohydrate causing an interaction" ; rdfs:subClassOf obo:MI_2308 . obo:MI_2310 obo:IAO_0000115 "Carbohydrate species chemically attached to proteins, or other organic molecules involved in an interaction that has no effect over an interaction when compared with the non-glycosylated molecule, which does not interact." ; oboInOwl:created_by "pporras" ; oboInOwl:creation_date "2018-09-14T10:40:12Z" ; oboInOwl:hasExactSynonym "attached carbohydrate not affecting interaction", "glycosylation with no effect" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2310" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "attached carbohydrate with no effect" ; rdfs:subClassOf obo:MI_2308 . obo:MI_2311 obo:IAO_0000115 "Carbohydrate species chemically attached to proteins, or other organic molecules involved in an interaction that decreases significantly interaction strength or rate (in the case of interactions inferred from enzymatic reaction) when compared with the non-glycosylated molecule." ; oboInOwl:created_by "pporras" ; oboInOwl:creation_date "2018-09-14T10:42:27Z" ; oboInOwl:hasExactSynonym "attached carbohydrate decreasing", "glycosylation decreasing interaction" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2311" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "attached carbohydrate decreasing interaction" ; rdfs:subClassOf obo:MI_2308 . obo:MI_2312 obo:IAO_0000115 "Carbohydrate species chemically attached to proteins, or other organic molecules involved in an interaction that increases significantly interaction strength or rate (in the case of interactions inferred from enzymatic reaction) when compared with the non-glycosylated molecule." ; oboInOwl:created_by "pporras" ; oboInOwl:creation_date "2018-09-14T10:46:39Z" ; oboInOwl:hasExactSynonym "attached carbohydrate increasing", "glycosylation increasing interaction" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2312" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "attached carbohydrate increasing interaction" ; rdfs:subClassOf obo:MI_2308 . obo:MI_2313 obo:IAO_0000115 "Carbohydrate species chemically attached to proteins, or other organic molecules involved in an interaction that increases significantly interaction strength when compared with the non-glycosylated molecule." ; oboInOwl:created_by "pporras" ; oboInOwl:creation_date "2018-09-14T10:47:14Z" ; oboInOwl:hasExactSynonym "attached carbohydrate increasing strength", "glycosylation increasing strength" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2313" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "attached carbohydrate increasing interaction strength" ; rdfs:subClassOf obo:MI_2312 . obo:MI_2314 obo:IAO_0000115 "Carbohydrate species chemically attached to proteins, or other organic molecules involved in an interaction that increases significantly interaction rate (in the case of interactions inferred from enzymatic reaction) when compared with the non-glycosylated molecule." ; oboInOwl:created_by "pporras" ; oboInOwl:creation_date "2018-09-14T10:49:39Z" ; oboInOwl:hasExactSynonym "attached carbohydrate increasing rate", "glycosylation increasing rate" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2314" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "attached carbohydrate increasing interaction rate" ; rdfs:subClassOf obo:MI_2312 . obo:MI_2315 obo:IAO_0000115 "Carbohydrate species chemically attached to proteins, or other organic molecules involved in an interaction that disrupts interaction rate (in the case of interactions inferred from enzymatic reaction) when compared with the non-glycosylated molecule." ; oboInOwl:created_by "pporras" ; oboInOwl:creation_date "2018-09-14T10:50:23Z" ; oboInOwl:hasExactSynonym "attached carbohydrate disrupting rate", "glycosylation disrupting rate" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2315" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "attached carbohydrate disrupting interaction rate" ; rdfs:subClassOf obo:MI_2311, obo:MI_2317 . obo:MI_2316 obo:IAO_0000115 "Carbohydrate species chemically attached to proteins, or other organic molecules involved in an interaction that disrupts interaction strength when compared with the non-glycosylated molecule." ; oboInOwl:created_by "pporras" ; oboInOwl:creation_date "2018-09-14T10:51:06Z" ; oboInOwl:hasExactSynonym "attached carbohydrate disrupting strength", "glycosylation disrupting strength" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2316" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "attached carbohydrate disrupting interaction strength" ; rdfs:subClassOf obo:MI_2311, obo:MI_2317 . obo:MI_2317 obo:IAO_0000115 "Carbohydrate species chemically attached to proteins, or other organic molecules involved in an interaction that disrupts interaction strength or rate (in the case of interactions inferred from enzymatic reaction) when compared with the non-glycosylated molecule." ; oboInOwl:created_by "pporras" ; oboInOwl:creation_date "2018-09-18T09:11:58Z" ; oboInOwl:hasExactSynonym "attached carbohydrate disrupting", "glycosylation disrupting interaction" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2317" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "attached carbohydrate disrupting interaction" ; rdfs:subClassOf obo:MI_2311 . obo:MI_2318 obo:IAO_0000115 "A technique that measures forces generated by interactions between molecules." ; oboInOwl:created_by "pporras" ; oboInOwl:creation_date "2018-10-11T13:41:11Z" ; oboInOwl:hasExactSynonym "intermolecular force" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:hasRelatedSynonym "molecular force measurement" ; oboInOwl:id "MI:2318" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "force measurement" ; rdfs:subClassOf obo:MI_0013 . obo:MI_2319 obo:IAO_0000115 "A technique that measures interaction force between two surfaces as they are brought together and retracted." ; oboInOwl:created_by "pporras" ; oboInOwl:creation_date "2018-10-11T13:44:53Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:hasRelatedSynonym "surface adhesion force measurement" ; oboInOwl:id "MI:2319" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "surface force measurement" ; rdfs:subClassOf obo:MI_2318 . obo:MI_2320 obo:IAO_0000115 """The Alzheimer's Research UK Gene Ontology Project represents a collaboration between University College London, the European Bioinformatics Institute (EBI) and the University of Manchester, funded by Alzheimer's Research UK. This annotation group is a member of the IMEx Consortium. www.ucl.ac.uk/functional-gene-annotation/neurological""" ; oboInOwl:created_by "pporras" ; oboInOwl:creation_date "2018-10-16T09:26:24Z" ; oboInOwl:hasExactSynonym "Alzheimer's Research UK Gene Ontology Project" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2320" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "aruk-ucl" ; rdfs:subClassOf obo:MI_0461 . obo:MI_2321 obo:IAO_0000115 "High-throughput (a.k.a. \"next-generation\") sequencing applies to methods that allow for sequencing of genome-scale number of bases." ; oboInOwl:created_by "pporras" ; oboInOwl:creation_date "2018-11-13T14:59:35Z" ; oboInOwl:hasExactSynonym "next-generation sequencing", "ngs sequencing" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2321" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "high-throughput sequencing" ; rdfs:subClassOf obo:MI_0078 . obo:MI_2322 obo:IAO_0000115 "This method generates several billion bases of accurate nucleotide sequence per experiment at low cost. Single molecules of DNA are attached to a flat surface, amplified in situ and used as templates for synthetic sequencing with fluorescent reversible terminator deoxyribonucleotides. Images of the surface are analysed to generate high-quality sequence." ; oboInOwl:created_by "pporras" ; oboInOwl:creation_date "2018-11-13T15:23:38Z" ; oboInOwl:hasExactSynonym "illumina sequencing", "solexa sequencing" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2322" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "Illumina dye sequencing" ; rdfs:subClassOf obo:MI_2321 . obo:MI_2323 obo:IAO_0000115 "KISS (KInase Substrate Sensor) is a protein complementation technology that allows in situ analysis of protein-protein interactions in intact mammalian cells. In this method, which is derived from MAPPIT (mammalian protein-protein interaction trap), the bait protein is coupled to the kinase domain of TYK2, while the prey protein is fused to a fragment of the gp130 cytokine receptor chain. Bait and prey interaction leads to phosphorylation of the gp130 anchor by TYK2, followed by recruitment and activation of STAT3, resulting in transcription of a STAT3-dependent reporter system. This approach enables the identification of interactions between proteins, including transmembrane and cytosolic proteins, and their modulation in response to physiological or pharmacological challenges." ; oboInOwl:created_by "pporras" ; oboInOwl:creation_date "2019-04-02T09:58:26Z" ; oboInOwl:hasExactSynonym "KISS", "kinase substrate sensor", "kiss" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2323" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "kiss" ; rdfs:subClassOf obo:MI_0090 . obo:MI_2324 obo:IAO_0000115 "dbSNP contains human single nucleotide variations, microsatellites, and small-scale insertions and deletions along with publication, population frequency, molecular consequence, and genomic and RefSeq mapping information for both common variations and clinical mutations." ; oboInOwl:created_by "pporras" ; oboInOwl:creation_date "2019-04-02T10:52:06Z" ; oboInOwl:hasDbXref "search-url:" ; oboInOwl:hasExactSynonym "dbSNP", "dbsnp" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2324" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "dbsnp" ; rdfs:subClassOf obo:MI_0447 . obo:MI_2325 obo:IAO_0000115 "NanoLuc luciferase (Nluc) is a small (19 kDa), highly stable, ATP independent, bioluminescent protein derived from the luciferase complex of the deep-sea shrimp O. gracilirostris." ; oboInOwl:created_by "pporras" ; oboInOwl:creation_date "2019-04-11T14:07:06Z" ; oboInOwl:hasExactSynonym "NLuc", "NanoLuc", "nanoluc luciferase", "nluc" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2325" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "nanoluc luciferase protein tag" ; rdfs:subClassOf obo:MI_1205 . obo:MI_2326 obo:IAO_0000115 "The n-terminus of the nanoluc luciferase protein, fused to a protein of interest for use in the split luciferase complementation assay." ; oboInOwl:created_by "pporras" ; oboInOwl:creation_date "2019-04-11T14:14:54Z" ; oboInOwl:hasExactSynonym "N-terminal fragment of nanoluc luciferase", "nluc-n" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2326" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "nanoluc-n" ; rdfs:subClassOf obo:MI_2325 . obo:MI_2327 obo:IAO_0000115 "The c-terminus of the nanoluc luciferase protein, fused to a protein of interest for use in the split luciferase complementation assay." ; oboInOwl:created_by "pporras" ; oboInOwl:creation_date "2019-04-11T14:16:59Z" ; oboInOwl:hasExactSynonym "C-terminal fragment of nanoluc luciferase", "nluc-c" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2327" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "nanoluc-c" ; rdfs:subClassOf obo:MI_2325 . obo:MI_2328 obo:IAO_0000115 "The SNAP-tag protein is an engineered version of the ubiquitous mammalian enzyme AGT, encoded in humans by the O-6-methylguanine-DNA methyltransferase (MGMT) gene. The tag is a 182 residues polypeptide with self-labeling activity that accepts O6-benzylguanine derivatives." ; oboInOwl:created_by "pporras" ; oboInOwl:creation_date "2019-04-23T10:19:29Z" ; oboInOwl:hasExactSynonym "SNAP tag", "snap tag" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2328" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "snap tag" ; rdfs:subClassOf obo:MI_0507 . obo:MI_2329 obo:IAO_0000115 "Hydrophobic interaction chromatography (HIC) separates proteins according to differences in their surface hydrophobicity by utilizing a reversible interaction between these proteins and the hydrophobic surface of a HIC matrix." ; oboInOwl:created_by "pporras" ; oboInOwl:creation_date "2019-04-23T13:40:51Z" ; oboInOwl:hasExactSynonym "HIC", "hic" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2329" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "hydrophobic interaction chromatography" ; rdfs:subClassOf obo:MI_0091 . obo:MI_2330 obo:IAO_0000115 "Covalent attachment of the small ubiquitin-like modifier (SUMO) protein as a fusion protein." ; oboInOwl:created_by "pporras" ; oboInOwl:creation_date "2019-07-11T15:50:31Z" ; oboInOwl:hasExactSynonym "SUMO tag", "sumo tag" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2330" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "sumo tag" ; rdfs:subClassOf obo:MI_0240 . obo:MI_2331 obo:IAO_0000115 "A bacteriophage library of genes encoding proteins or peptides fused to a phage coat protein that are expressed on the surface of the phage virion." ; oboInOwl:created_by "pporras" ; oboInOwl:creation_date "2019-07-11T15:54:51Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2331" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "phage library" ; rdfs:subClassOf obo:MI_0342 . obo:MI_2332 obo:IAO_0000115 "Paramagnetic molecule formed by a gadolinium complex based on 4-mercaptomethyl-dipicolinic acid (4MMDPA) attached to a cysteine side chain." ; oboInOwl:created_by "pporras" ; oboInOwl:creation_date "2019-07-11T16:04:14Z" ; oboInOwl:hasExactSynonym "Gd3+-4MMDPA tag", "g1 spin label", "g1-spin label" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2332" ; a owl:Class ; rdfs:label "g1 spin label" ; rdfs:subClassOf obo:MI_0845 . obo:MI_2333 obo:IAO_0000115 "A change in a sequence or structure in comparison to a reference entity due to a insertion, deletion or substitution event that has a complex effect over the interaction when compared with the wild-type. A complex effect is such that cannot be described in increasing, decreasing, causing, disrupting or no effect terms." ; oboInOwl:created_by "pporras" ; oboInOwl:creation_date "2019-07-11T16:17:45Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2333" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "mutation with complex effect" ; rdfs:subClassOf obo:MI_0118 . obo:MI_2334 obo:IAO_0000115 "Fluorophore or luminiscence source which emits electromagnetic radiation of given wavelength." ; oboInOwl:created_by "pporras" ; oboInOwl:creation_date "2019-07-11T16:26:29Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2334" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "luminescence donor" ; rdfs:subClassOf obo:MI_0495 . obo:MI_2335 obo:IAO_0000115 "Fluorophore able to absorb the electromagnetic radiation at given wavelength from a specific luminescence donor, then re-emit its own characteristic fluorescence. The luminescence donor may or may not be a fluorophore it self." ; oboInOwl:created_by "pporras" ; oboInOwl:creation_date "2019-07-11T16:26:47Z" ; oboInOwl:hasExactSynonym "luminescence accept" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2335" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "luminescence acceptor" ; rdfs:subClassOf obo:MI_0495 . obo:MI_2336 obo:IAO_0000115 "Pair of luminescence donor-fluorophore or fluorophores attached to the same molecule used in a bret or fret experiment to observe the details of conformational changes." ; oboInOwl:created_by "pporras" ; oboInOwl:creation_date "2019-07-11T16:27:09Z" ; oboInOwl:hasExactSynonym "luminescence acceptor-donor pair" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2336" ; a owl:Class ; rdfs:label "luminescence acceptor donor pair" ; rdfs:subClassOf obo:MI_0495 . obo:MI_2337 obo:IAO_0000115 "Luminiscence source which emits electromagnetic radiation of given wavelength through a chemical process." ; oboInOwl:created_by "pporras" ; oboInOwl:creation_date "2019-07-11T16:37:54Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2337" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "chemiluminiscence donor" ; rdfs:subClassOf obo:MI_2334 . obo:MI_2338 obo:IAO_0000115 "Three-dimensional (3D) reconstruction of single, transparent objects from a series of projection images from a tilt series recorded with a transmission electron microscope." ; oboInOwl:created_by "pporras" ; oboInOwl:creation_date "2019-07-17T13:23:36Z" ; oboInOwl:hasExactSynonym "3D-EM-tomo" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2338" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "electron tomography" ; rdfs:subClassOf obo:MI_0410 . obo:MI_2339 obo:IAO_0000115 "Three-dimensional (3D) reconstruction of single, transparent objects from a collection of images of randomly oriented particles recorded with a transmission electron microscope." ; oboInOwl:created_by "pporras" ; oboInOwl:creation_date "2019-07-22T13:39:03Z" ; oboInOwl:hasExactSynonym "3D-EM-single" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2339" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "electron microscopy 3D single particle reconstruction" ; rdfs:subClassOf obo:MI_0410 . obo:MI_2340 obo:IAO_0000115 "Three-dimensional (3D) reconstruction of helical objects from a collection of fiber images recorded with a transmission electron microscope." ; oboInOwl:created_by "pporras" ; oboInOwl:creation_date "2019-07-22T13:40:56Z" ; oboInOwl:hasExactSynonym "3D-EM-helical" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2340" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "electron microscopy 3D helical reconstruction" ; rdfs:subClassOf obo:MI_0410 . obo:MI_2341 obo:IAO_0000115 "Fluorophore able to absorb the electromagnetic radiation at given wavelength from a specific luminescence donor and then act as a donor via re-emission of its own characteristic fluorescence. The luminescence donor may or may not be a fluorophore itself." ; oboInOwl:created_by "pporras" ; oboInOwl:creation_date "2019-07-22T13:51:08Z" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2341" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "luminescence transmitter" ; rdfs:subClassOf obo:MI_0495 . obo:MI_2342 obo:IAO_0000115 "Reference to the corresponding object in another database. Correspondence is partial, so the objects are similar but explicitly not identical." ; oboInOwl:created_by "pporras" ; oboInOwl:creation_date "2019-07-30T15:05:43Z" ; oboInOwl:hasExactSynonym "partial match", "similar object in an external resource" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2342" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "partial identity match" ; rdfs:subClassOf obo:MI_0353 . obo:MI_2343 obo:IAO_0000115 "Coordinates of a reference DNA sequence in the genome, providing information about the chromosome name, start and end of the sequence, optionally including the strand as well if it applies." ; oboInOwl:created_by "pporras" ; oboInOwl:creation_date "2019-07-30T16:06:16Z" ; oboInOwl:hasExactSynonym "genomic coord" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2343" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "genomic coordinates" ; rdfs:subClassOf obo:MI_0666, obo:MI_0668 . obo:MI_2344 obo:IAO_0000115 "Rhea is an expert curated resource of biochemical reactions designed for the annotation of enzymes and genome-scale metabolic networks and models. Rhea uses the ChEBI (Chemical Entities of Biological Interest) ontology of small molecules to precisely describe reactions participants and their chemical structures. All reactions are balanced for mass and charge and are linked to source literature, metabolic resources and other functional vocabularies such as the enzyme classification of the NC-IUBMB." ; oboInOwl:created_by "pporras" ; oboInOwl:creation_date "2019-10-28T17:31:37Z" ; oboInOwl:hasDbXref "search-url:" ; oboInOwl:hasExactSynonym "Rhea" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2344" ; a owl:Class ; rdfs:label "rhea" ; rdfs:subClassOf obo:MI_0461 . obo:MI_2345 obo:IAO_0000115 "The protein is fused to a 12-residue peptide segment (GVAMPGAEDDVV) derived from human podoplanin PLAG domain for which antibodies are available." ; oboInOwl:created_by "pporras" ; oboInOwl:creation_date "2019-10-30T16:29:27Z" ; oboInOwl:hasExactSynonym "PA tag" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2345" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "pa tag" ; rdfs:subClassOf obo:MI_0507 . obo:MI_2346 obo:IAO_0000115 "Protein is fused to a 21 amino acid residues-long peptide (YPGQYPGQYPGQYPGQYPGQV) derived from human PAR-4 N-terminal peptide. The final sequence of the peptide resulted from optimization involving mutagenesis and repetition of the original reference sequence in order to maximize affinity with the P20.1 antibody." ; oboInOwl:created_by "pporras" ; oboInOwl:creation_date "2019-10-30T16:41:19Z" ; oboInOwl:hasExactSynonym "TARGET tag", "tandemly-arranged recognition motif combined with gentle elution technology tag" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2346" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "target tag" ; rdfs:subClassOf obo:MI_0507 . obo:MI_2347 obo:IAO_0000115 """bioRxiv is a free online archive and distribution service for unpublished preprints in the life sciences, operated by Cold Spring Harbor Laboratory. Articles are not peer-reviewed, edited, or typeset before being posted online. http://biorxiv.org/""" ; oboInOwl:created_by "pporras" ; oboInOwl:creation_date "2019-10-30T16:49:12Z" ; oboInOwl:hasDbXref "id-validation-regexp:", "search-url:" ; oboInOwl:hasExactSynonym "bioRxiv" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2347" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "biorxiv" ; rdfs:subClassOf obo:MI_0445 . obo:MI_2348 obo:IAO_0000115 "In sequential BRET-FRET (BRET combined with FRET) bioluminiscence generated by a luciferase triggers acceptor excitation by BRET and subsequent energy transfer to a FRET acceptor. This technique can identify multimolecular complexes through detection of the resulting fluoresecence." ; oboInOwl:created_by "pporras" ; oboInOwl:creation_date "2019-10-30T17:07:01Z" ; oboInOwl:hasExactSynonym "SRET", "Sequential BRET-FRET", "sret" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2348" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "sequential bret-fret" ; rdfs:subClassOf obo:MI_0051 . obo:MI_2349 obo:IAO_0000115 """ClinVar is a freely accessible, public archive of reports of the relationships among human variations and phenotypes, with supporting evidence. https://www.ncbi.nlm.nih.gov/clinvar""" ; oboInOwl:created_by "pporras" ; oboInOwl:creation_date "2019-10-30T17:16:41Z" ; oboInOwl:hasDbXref "id-validation-regexp:", "search-url:" ; oboInOwl:hasExactSynonym "ClinVAR" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2349" ; a owl:Class ; rdfs:label "clinvar" ; rdfs:subClassOf obo:MI_0447 . obo:MI_2350 obo:IAO_0000115 """EMPIAR, the Electron Microscopy Public Image Archive, is a public resource for raw, 2D electron microscopy images. The purpose of EMPIAR is to provide easy access to state-of-the-art raw data to facilitate methods development and validation, which will lead to better 3D structures. It complements the Electron Microscopy Data Bank (EMDB), where 3D volumes are stored, and uses the fault-tolerant Aspera platform for data transfers. https://www.ebi.ac.uk/empiar""" ; oboInOwl:created_by "pporras" ; oboInOwl:creation_date "2019-12-17T09:31:30Z" ; oboInOwl:hasDbXref "id-validation-regex:", "search-url:" ; oboInOwl:hasExactSynonym "EMPIAR", "Electron Microscopy Public Image Archive", "empiar" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2350" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "empiar" ; rdfs:subClassOf obo:MI_0936 . obo:MI_2351 obo:IAO_0000115 "A gene whose genetic perturbation enhances the phenotype resulting from a different genetic perturbation." ; oboInOwl:created_by "pporras" ; oboInOwl:creation_date "2020-02-12T14:19:39Z" ; oboInOwl:hasExactSynonym "enhancer" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2351" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "enhancer gene" ; rdfs:subClassOf obo:MI_0495 . obo:MI_2352 obo:IAO_0000115 "A gene whose genetic perturbation phenotype is enhanced by a different genetic perturbation." ; oboInOwl:created_by "pporras" ; oboInOwl:creation_date "2020-02-12T14:21:40Z" ; oboInOwl:hasExactSynonym "enhanced" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2352" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "enhanced gene" ; rdfs:subClassOf obo:MI_0495 . obo:MI_2353 obo:IAO_0000115 "A gene whose genetic perturbation masks the phenotype resulting from a different genetic perturbation." ; oboInOwl:created_by "pporras" ; oboInOwl:creation_date "2020-02-12T14:22:57Z" ; oboInOwl:hasExactSynonym "epistatic" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2353" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "epistatic gene" ; rdfs:subClassOf obo:MI_0495 . obo:MI_2354 obo:IAO_0000115 "A gene whose genetic perturbation phenotype is masked by a different genetic perturbation." ; oboInOwl:created_by "pporras" ; oboInOwl:creation_date "2020-02-12T14:24:11Z" ; oboInOwl:hasExactSynonym "hypostatic" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2354" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "hypostatic gene" ; rdfs:subClassOf obo:MI_0495 . obo:MI_2355 obo:IAO_0000115 "Measurement of the substraction of one or more ADP-ribose moieties to molecules." ; oboInOwl:created_by "pporras" ; oboInOwl:creation_date "2020-06-02T17:02:11Z" ; oboInOwl:hasExactSynonym "adp deribosylase" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:hasRelatedSynonym "adp deribosylation" ; oboInOwl:id "MI:2355" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "adp deribosylase assay" ; rdfs:subClassOf obo:MI_0415 . obo:MI_2356 obo:IAO_0000115 "Involves the substraction of one or more ADP-ribose moieties to proteins. Reaction that can affect Arg, Cys, Glu, Arg and Asn residues." ; oboInOwl:created_by "pporras" ; oboInOwl:creation_date "2020-06-02T17:02:30Z" ; oboInOwl:hasExactSynonym "adp de-ribosylation", "adp deribosylation" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2356" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "adp deribosylation reaction" ; rdfs:subClassOf obo:MI_0414 . obo:MI_2357 obo:IAO_0000115 "This parameter represents the rate of the reaction at negligible substrate concentration, indicating how the velocity varies according to how often enzyme and substrate combine." ; oboInOwl:created_by "pporras" ; oboInOwl:creation_date "2020-06-30T16:04:54Z" ; oboInOwl:hasExactSynonym "catalytic efficiency", "kcat/km", "specificity constant" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2357" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "kcat/km" ; rdfs:subClassOf obo:MI_0640 . obo:MI_2358 obo:IAO_0000115 """A searchable database of published miRNA sequences and annotation. Each entry in the miRBase Sequence database represents a predicted hairpin portion of a miRNA transcript (termed mir in the database), with information on the location and sequence of the mature miRNA sequence (termed miR). Both hairpin and mature sequences are available for searching and browsing, and entries can also be retrieved by name, keyword, references and annotation. All sequence and annotation data are also available for download. Homepage: http://www.mirbase.org/""" ; oboInOwl:created_by "pporras" ; oboInOwl:creation_date "2020-06-30T17:05:08Z" ; oboInOwl:hasDbXref "search-url:" ; oboInOwl:hasExactSynonym "miRBASE" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2358" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "mirbase" ; rdfs:subClassOf obo:MI_0461 . obo:MI_2359 obo:IAO_0000115 "RNA that consists of two base pairing strands. The 2 nucleotide chains are held together by hydrogen bonds between base pairs of nucleotides." ; oboInOwl:created_by "pporras" ; oboInOwl:creation_date "2020-07-01T16:15:22Z" ; oboInOwl:hasExactSynonym "double stranded ribonucleic acid" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2359" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "ds rna" ; rdfs:subClassOf obo:MI_0320 . obo:MI_2360 obo:IAO_0000115 "Protein is fused to beta-galactosidase, and the measure of this enzyme activity can be taken as indicative of presence of protein." ; oboInOwl:created_by "pporras" ; oboInOwl:creation_date "2020-07-01T16:18:26Z" ; oboInOwl:hasExactSynonym "beta gal tag", "beta-galactosidase tag" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2360" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "beta gal tag" ; rdfs:subClassOf obo:MI_0365 . obo:MI_2361 obo:IAO_0000115 "Bait protein is fused to a standard protein fusion tag and an intein fragment, prey a with a different protein fusion tag and the complementary intein fragment. The bait and prey are co-expressed in a cell line where the association of bait and prey brings the intein fragments into close proximity, allowing them to reconstitute a fully functional intein, which then catalyzes its own excision and the concurrent ligation of the bait and the prey peptides (as well as the standard protein fusion tags). The resulting spliced protein can be resolved by regular western blot analysis due to its altered mobility, while the presence of the standard protein fusion tags allows visualization or purification of protein using regular biochemical techniques." ; oboInOwl:created_by "pporras" ; oboInOwl:creation_date "2020-12-02T11:31:51Z" ; oboInOwl:hasExactSynonym "SIMPL", "simpl" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2361" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "Split Intein-Mediated Protein Ligation" ; rdfs:subClassOf obo:MI_0090 . obo:MI_2362 obo:IAO_0000115 "Intein C-terminal fragment tag, commonly used in SIMPL and related methods." ; oboInOwl:created_by "pporras" ; oboInOwl:creation_date "2020-12-02T11:39:05Z" ; oboInOwl:hasExactSynonym "IC tag", "intein c-terminal fragment tag" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2362" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "ic tag" ; rdfs:subClassOf obo:MI_0507 . obo:MI_2363 obo:IAO_0000115 "Intein N-terminal fragment tag, commonly used in SIMPL and related methods." ; oboInOwl:created_by "pporras" ; oboInOwl:creation_date "2020-12-02T11:40:48Z" ; oboInOwl:hasExactSynonym "IN tag", "intein n-terminal fragment tag" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2363" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "in tag" ; rdfs:subClassOf obo:MI_0507 . obo:MI_2364 obo:IAO_0000115 "Coincident occurrence of molecules within very close proximity (in the nanometer range), detected through molecule-level resolution methodology, but from which a physical interaction among those molecules cannot be inferred." ; oboInOwl:created_by "pporras" ; oboInOwl:creation_date "2020-12-02T11:42:19Z" ; oboInOwl:hasExactSynonym "close-contact colocalization", "neighbourhood interaction" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2364" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "proximity" ; rdfs:subClassOf obo:MI_0403 . obo:MI_2365 obo:IAO_0000115 "FluoPPI system (Fluorescent Protein-Protein Interaction-visualization):-FLUOPPI utilises the formation of fluorescence foci whereby the interacting proteins of interest are genetically fused with either a tetramerizing fluorescent protein (FP-tag) or an assembly helper tag (Ash-tag). The incorporation of these tags onto a pair of interacting proteins enables the formation of intensely bright foci when co-expressed in mammalian cells. In these foci the FP-tag induces the fused protein to form a tetramer that can now interact with up to 4 copies of the Ash-tagged partner protein. The cognate interacting protein also forms an oligomer through the Ash tag, which in turn can interact with multiple copies of the FP-fused partner protein. The potential of both constructs to interact with multiple copies of each other enable large foci incorporating the fluorescent protein to form, which can be clearly observed when imaging the cell." ; oboInOwl:created_by "pporras" ; oboInOwl:creation_date "2020-12-07T17:35:40Z" ; oboInOwl:hasExactSynonym "FluoPPI", "fluoppi" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2365" ; a owl:Class ; rdfs:label "fluorescent protein-protein interaction-visualization" ; rdfs:subClassOf obo:MI_0428 . obo:MI_2366 obo:IAO_0000115 "The phenotype outcome resulting from two or more genetic perturbations to an organism, individually and in combination." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2366" ; a owl:Class ; rdfs:label "multigenic phenotype result" ; rdfs:subClassOf obo:MI_2384 . obo:MI_2367 obo:IAO_0000115 "A multigenic phenotype result in which the phenotype of a single genetic perturbation has been modified by the introduction of one or more additional genetic perturbations." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2367" ; a owl:Class ; rdfs:label "genetic interaction (sensu phenotype modification)" ; rdfs:subClassOf obo:MI_2402 . obo:MI_2368 obo:IAO_0000115 "Genetic perturbation of multiple genes in combination that results in a more severe phenotype (except lethality or growth defect) than individual genetic perturbations." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2368" ; a owl:Class ; rdfs:label "phenotypic enhancement (sensu BioGRID)" ; rdfs:subClassOf obo:MI_2380 . obo:MI_2369 obo:IAO_0000115 "Mutation of multiple genes in combination that results in a more severe growth defect than from individual mutation." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2369" ; a owl:Class ; rdfs:label "synthetic growth defect (sensu BioGRID)" ; rdfs:subClassOf obo:MI_2402 . obo:MI_2370 obo:IAO_0000115 "Mutation of multiple genes in combination that results in lethality when individual single mutations are viable." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2370" ; a owl:Class ; rdfs:label "synthetic lethality (sensu BioGRID)" ; rdfs:subClassOf obo:MI_0794, obo:MI_2394 . obo:MI_2371 obo:IAO_0000115 "Genetic perturbation of multiple genes in combination that results in a less severe phenotype than from individual perturbations. This term is reserved for high throughput studies with scores." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2371" ; a owl:Class ; rdfs:label "positive genetic interaction (sensu BioGRID)" ; rdfs:subClassOf obo:MI_2379 . obo:MI_2372 obo:IAO_0000115 "Genetic perturbations of multiple genes in combination that results in a more severe growth defect than each individual perturbation, when one mutation is hemizygous." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2372" ; a owl:Class ; rdfs:label "synthetic haploinsufficiency (sensu BioGRID)" ; rdfs:subClassOf obo:MI_2402 . obo:MI_2373 obo:IAO_0000115 "Genetic perturbation of multiple genes in combination that results in a more severe phenotypic defect (or lethality) than from individual viable perturbations. This term is reserved for high throughput studies with scores." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2373" ; a owl:Class ; rdfs:label "negative genetic interaction (sensu BioGRID)" ; rdfs:subClassOf obo:MI_2402 . obo:MI_2374 obo:IAO_0000115 "Genetic perturbation of one gene suppresses a phenotype (other than lethality or growth defect) associated with perturbation of another gene." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2374" ; a owl:Class ; rdfs:label "phenotypic suppression (sensu BioGRID)" ; rdfs:subClassOf obo:MI_2379 . obo:MI_2375 obo:IAO_0000115 "Mutation of one gene rescues lethality or a growth defect associated with perturbation of another gene." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2375" ; a owl:Class ; rdfs:label "synthetic rescue (sensu BioGRID)" ; rdfs:subClassOf obo:MI_2379, obo:MI_2395 . obo:MI_2376 obo:IAO_0000115 "Increased dosage of one gene rescues lethality or a growth defect associated with perturbation of another gene." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2376" ; a owl:Class ; rdfs:label "dosage rescue (sensu BioGRID)" ; rdfs:subClassOf obo:MI_2379, obo:MI_2395 . obo:MI_2377 obo:IAO_0000115 "Increased dosage of one gene causes lethality in combination with another viable genetic perturbation." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2377" ; a owl:Class ; rdfs:label "dosage lethality (sensu BioGRID)" ; rdfs:subClassOf obo:MI_0794, obo:MI_2394 . obo:MI_2378 obo:IAO_0000115 "Increased dosage of one gene causes a growth defect in (or enhances an existing growth defect of) a strain with perturbation of another gene." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2378" ; a owl:Class ; rdfs:label "dosage growth defect (sensu BioGRID)" ; rdfs:subClassOf obo:MI_2399 . obo:MI_2379 obo:IAO_0000115 "A genetic phenotype modification whereby one genetic perturbation suppresses, or alleviates, the phenotype of another genetic perturbation. Note that if the individual genetic perturbations have opposite phenotypes, this may be an expected result." ; oboInOwl:hasExactSynonym "suppressing genetic interaction" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2379" ; a owl:Class ; rdfs:label "genetic suppression" ; rdfs:subClassOf obo:MI_2367 . obo:MI_2380 obo:IAO_0000115 "A genetic phenotype modification whereby one genetic perturbation enhances, or exacerbates, the phenotype of another genetic perturbation. Note that this may be an expected result." ; oboInOwl:hasExactSynonym "enhancing genetic interaction" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2380" ; a owl:Class ; rdfs:label "genetic enhancement" ; rdfs:subClassOf obo:MI_2367 . obo:MI_2381 obo:IAO_0000115 "A phenotype result in which each of multiple perturbations results in no (or only a minimal) phenotype for the phenotype in question." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2381" ; a owl:Class ; rdfs:label "aphenotypic phenotype result" ; rdfs:subClassOf obo:MI_2384 . obo:MI_2382 obo:IAO_0000115 "A phenotype result in which only one of multiple perturbations results in the phenotype in question." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2382" ; a owl:Class ; rdfs:label "monophenotypic phenotype result" ; rdfs:subClassOf obo:MI_2384 . obo:MI_2383 obo:IAO_0000115 "The expression of a phenotype in an organism or a population of organisms resulting from one or more organismal perturbations, including genetic perturbations and environmental (including chemical/drug exposure) perturbations." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2383" ; a owl:Class ; rdfs:label "phenotype result" ; rdfs:subClassOf obo:MI_0190 . obo:MI_2384 obo:IAO_0000115 "A phenotype result in which multiple perturbations affect an organism individually and in combination." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2384" ; a owl:Class ; rdfs:label "multiple perturbation phenotype result" ; rdfs:subClassOf obo:MI_2383 . obo:MI_2385 obo:IAO_0000115 "A phenotype result in which both of two perturbations result in the phenotype in question and do so in the same manner compared to wild type. For example, both perturbations result in an increased quality phenotype, or both perturbations result in a decreased quality phenotype." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2385" ; a owl:Class ; rdfs:label "cisphenotypic phenotype result" ; rdfs:subClassOf obo:MI_2384 . obo:MI_2386 obo:IAO_0000115 "A cisphenotypic phenotype result in which both of two perturbations result in the same phenotype, both in manner and degree, compared to wild type." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2386" ; a owl:Class ; rdfs:label "isophenotypic phenotype result" ; rdfs:subClassOf obo:MI_2385 . obo:MI_2387 obo:IAO_0000115 "A phenotype result in which two perturbations result in the opposite phenotype compared to wild type. For example, one perturbation results in an increased quality phenotype and the second perturbation results in a decreased quality phenotype." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2387" ; a owl:Class ; rdfs:label "transphenotypic phenotype result" ; rdfs:subClassOf obo:MI_2384 . obo:MI_2388 obo:IAO_0000115 "A genetic phenotype modification whereby introduction of one genetic perturbation to another genetic perturbation results in the opposite phenotype compared to the phenotype of the starting individual genetic perturbation. For example, one perturbation results in an increased quality phenotype and introduction of the second perturbation results in a decreased quality phenotype. Note that if the individual genetic perturbations have opposite phenotypes, this may be an expected result." ; oboInOwl:hasExactSynonym "super-suppressing genetic interaction" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2388" ; a owl:Class ; rdfs:label "genetic over-suppression" ; rdfs:subClassOf obo:MI_2379 . obo:MI_2389 obo:IAO_0000115 "A genetic phenotype modification whereby each of two genetic perturbations suppress, or alleviate, the phenotype of the other genetic perturbation. Note that if the individual genetic perturbations have opposite phenotypes, this may be an expected result." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2389" ; a owl:Class ; rdfs:label "mutual genetic suppression" ; rdfs:subClassOf obo:MI_2379 . obo:MI_2390 obo:IAO_0000115 "A genetic mutual suppression in which each genetic perturbation results in opposite phenotypes (for example, one genetic perturbation results in an increased quality phenotype and the second genetic perturbation results in a decreased quality phenotype), and their combination (the double genetic perturbation) results in an intermediate phenotype that is at least closer to wild type than the most severe phenotype of the individual genetic perturbations. Note that the double genetic perturbation phenotype may be expected according to some chosen neutrality function." ; oboInOwl:hasExactSynonym "transphenotypic suppressing genetic interaction" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2390" ; a owl:Class ; rdfs:label "transphenotypic genetic suppression" ; rdfs:subClassOf obo:MI_2387, obo:MI_2389 . obo:MI_2391 obo:IAO_0000115 "A transphenotypic suppression in which the double genetic perturbation phenotype is equivalent to the wild type (or control) phenotype." ; oboInOwl:hasExactSynonym "transphenotypic all-suppressing genetic interaction" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2391" ; a owl:Class ; rdfs:label "transphenotypic genetic suppression (complete)" ; rdfs:subClassOf obo:MI_1281, obo:MI_2390 . obo:MI_2392 obo:IAO_0000115 "A genetic enhancement in which the double genetic perturbation phenotype is equivalent to the expected phenotype, according to some chosen neutrality function." ; oboInOwl:hasExactSynonym "cisphenotypic enhancing neutral genetic interaction" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2392" ; a owl:Class ; rdfs:label "mutual genetic enhancement (expected)" ; rdfs:subClassOf obo:MI_0932, obo:MI_2401 . obo:MI_2393 obo:IAO_0000115 "A transphenotypic suppression in which the double genetic perturbation phenotype is expected, according to some chosen neutrality function." ; oboInOwl:hasExactSynonym "transphenotypic suppressing neutral genetic interaction" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2393" ; a owl:Class ; rdfs:label "transphenotypic genetic suppression (expected)" ; rdfs:subClassOf obo:MI_0932, obo:MI_2390 . obo:MI_2394 obo:IAO_0000115 "An effect in which two genetic perturbations, when combined, result in a fitness that is less than expected given the fitness resulting from the individual perturbations." ; mi:isDefinedBy "Negative genetic interactions describe double mutants whose phenotype is stronger than expected (66, 77) (Figure 1b).", "Negative interactions (also called aggravating or synergistic interactions) describe double mutants exhibiting a more severe phenotype than expected, such as synthetic sickness or synthetic lethality (35, 49) (Figure 2a)." ; oboInOwl:hasBroadSynonym "aggravating interaction", "synergistic interaction" ; oboInOwl:hasExactSynonym "negative gen int" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2394" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "negative genetic interaction" ; rdfs:subClassOf obo:MI_0933 . obo:MI_2395 obo:IAO_0000115 "An effect in which two genetic perturbations, when combined, result in a fitness that is greater than expected given the fitness resulting from the individual perturbations." ; mi:isDefinedBy "Positive genetic interactions define double mutants whose phenotype is less severe than expected based on single-mutant phenotypes (30, 66, 87) (Figure 1c,d).", "Positive interactions describe double mutants exhibiting a less severe phenotype than expected from the multiplicative model. Positive interactions have also been referred to as alleviating or epistatic interactions." ; oboInOwl:hasBroadSynonym "alleviating interaction" ; oboInOwl:hasExactSynonym "positive gent int" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2395" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "positive genetic interaction" ; rdfs:subClassOf obo:MI_0935 . obo:MI_2396 obo:IAO_0000115 """An effect in which individual perturbations of different genes result in the same mutant phenotype (but, perhaps, to varying degrees of severity/penetrance) and the resulting phenotype of their combination is equivalent to the wild type phenotype. With respect to any single quantifiable phenotype, this may be expressed as an inequality as: (a* <= b < wt) AND (ab = wt) [E = a*] OR (wt < b <= a*) AND (ab = wt) [E = a*] where 'a' and 'b' are the observed phenotype values of the individual perturbations ('a*' being the most severe of the two), 'ab' is the observed phenotype value of the double perturbation, 'E' is the expected phenotype value of the double perturbation, and 'wt' is the wild type phenotype value.""" ; oboInOwl:hasExactSynonym "cisphenotypic all-suppressing converging genetic interaction", "cisphenotypic all-suppressing genetic interaction" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2396" ; a owl:Class ; rdfs:label "cisphenotypic genetic suppression (complete)" ; rdfs:subClassOf obo:MI_1280, obo:MI_1281 . obo:MI_2397 obo:IAO_0000115 """An effect in which individual perturbations of different genes result in the same mutant phenotype but to varying degrees of severity/penetrance and the resulting phenotype of their combination is less severe/penetrant than both of the phenotypes resulting from the individual perturabtions. With respect to any single quantifiable phenotype, this may be expressed as an inequality as: a* < b < ab < wt [E = a*] OR wt < ab < b < a* [E = a*] where 'a' and 'b' are the observed phenotype values of the individual perturbations ('a*' being the most severe of the two), 'ab' is the observed phenotype value of the double perturbation, 'E' is the expected phenotype value of the double perturbation, and 'wt' is the wild type phenotype value.""" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2397" ; a owl:Class ; rdfs:label "cisphenotypic co-suppressing genetic interaction" ; rdfs:subClassOf obo:MI_1282 . obo:MI_2398 obo:IAO_0000115 """A genetic aphenotypic phenotype result (both genetic perturbations result in a wild type (or control) phenotype) in which case the double genetic perturbation also results in the wild type (or control) phenotype, thus resulting in the expected phenotype. With respect to any single quantifiable phenotype, this may be expressed as an inequality as: wt = a = b = ab [E = wt] where 'a' and 'b' are the observed phenotype values of the individual perturbations, 'ab' is the observed phenotype value of the double perturbation, 'E' is the expected phenotype value of the double perturbation, and 'wt' is the wild type phenotype value.""" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2398" ; a owl:Class ; rdfs:label "aphenotypic neutral multigenic phenotype result" ; rdfs:subClassOf obo:MI_0932, obo:MI_2381 . obo:MI_2399 obo:IAO_0000115 "A phenotype modification whereby introduction of a genetic perturbation in an organism with another genetic perturbation results in, or enhances, a phenotype in that organism." ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2399" ; a owl:Class ; rdfs:label "deleterious multigenic phenotype result" ; rdfs:subClassOf obo:MI_2366 . obo:MI_2400 obo:IAO_0000115 """A phenotype result in which only one of two perturbations results in the phenotype in question and the phenotype of the combined perturbations a and b result in the expected phenotype, namely the same phenotype as the single perturbation that exhibits that phenotype. The interpretation is that no interaction was observed between the two genes, for the indicated phenotype. With respect to any single quantifiable phenotype, this may be expressed as an inequality as: ab = a ≠ wt = b [E = a] where 'a' and 'b' are the observed phenotype values of the individual perturbations, 'ab' is the observed phenotype value of the double perturbation, 'E' is the expected phenotype value of the double perturbation, and 'wt' is the wild type phenotype value.""" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2400" ; a owl:Class ; rdfs:label "monophenotypic neutral multigenic phenotype result" ; rdfs:subClassOf obo:MI_0932, obo:MI_2382 . obo:MI_2401 obo:IAO_0000115 "A phenotype result in which both of two genetic perturbations result in the phenotype in question and do so in the same manner compared to wild type (for example, both genetic perturbations result in an increased quality phenotype, or both genetic perturbations result in a decreased quality phenotype) and the resulting double genetic perturbation results in a phenotype that is more severe than the most severe single genetic perturbation phenotype. Note that this may be an expected result." ; oboInOwl:hasExactSynonym "cisphenotypic enhancing genetic interaction" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2401" ; a owl:Class ; rdfs:label "mutual genetic enhancement" ; rdfs:subClassOf obo:MI_2380, obo:MI_2385 . obo:MI_2402 obo:IAO_0000115 """A multigenic phenotype result in which (1) the phenotype of a single genetic perturbation has been modified by the introduction of one or more additional genetic perturbations AND/OR (2) an effect in which two genetic perturbations, when combined, result in a phenotype that does not appear to be merely explained by the superimposition or addition of effects of the original perturbations. ab (not=) E""" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2402" ; a owl:Class ; rdfs:label "genetic interaction" ; rdfs:subClassOf obo:MI_2366 . obo:MI_2403 obo:IAO_0000115 "E. coli BirA* biotin ligase tag used in BioID experiments. This generally refers to a promiscuous mutant version of the biotin ligase with an R118H mutation." ; oboInOwl:created_by "pporras" ; oboInOwl:creation_date "2021-03-22T14:27:04Z" ; oboInOwl:hasExactSynonym "BirA* biotin ligase tag", "BirA* tag", "bira biotin ligase tag", "bira tag" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2403" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "bira tag" ; rdfs:subClassOf obo:MI_0507 . obo:MI_2404 obo:IAO_0000115 "Enzymatic oxido-reductions where only O2 is an acceptor of hydrogen or electrons" ; oboInOwl:created_by "Licata" ; oboInOwl:creation_date "2021-07-05T23:48:40Z" ; oboInOwl:hasExactSynonym "oxidase" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2404" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "oxidase assay" ; rdfs:subClassOf obo:MI_0979 . obo:MI_2405 obo:IAO_0000115 "Circular RNAs are stable circular transcripts generated when a pre-mRNA undergoes “backsplicing” to join a splice donor to an upstream splice acceptor. They can originate from exons, introns or lncRNAs." ; oboInOwl:created_by "Licata" ; oboInOwl:creation_date "2021-12-15T11:55:10Z" ; oboInOwl:hasExactSynonym "circRNA" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2405" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "circular RNA" ; rdfs:subClassOf obo:MI_0320 . obo:MI_2406 obo:IAO_0000115 "Ribozymes (ribonucleic acid enzymes) are folded catalytic RNA molecules that perform important biological functions." ; oboInOwl:created_by "Licata" ; oboInOwl:creation_date "2022-03-01T16:49:20Z" ; oboInOwl:hasExactSynonym "ribozyme" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2406" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "ribozyme" ; rdfs:subClassOf obo:MI_0500 . obo:MI_2407 obo:IAO_0000115 """Uberon is an integrated cross-species anatomy ontology representing a variety of entities classified according to traditional anatomical criteria such as structure, function and developmental lineage. https://www.ebi.ac.uk/ols/ontologies/uberon""" ; oboInOwl:created_by "Licata" ; oboInOwl:hasExactSynonym "uberon" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2407" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "Uberon" ; rdfs:subClassOf obo:MI_0473 . obo:MI_2408 obo:IAO_0000115 """The COVID-19 Vocabulary (COVoc) is an ontology containing terms related to the research of the COVID-19 pandemic. This includes host organisms, pathogenicity, gene and gene products, barrier gestures, treatments and more. https://www.ebi.ac.uk/ols/ontologies/COVOC""" ; oboInOwl:created_by "Licata" ; oboInOwl:hasExactSynonym "COVID-19 Vocabulary", "CoVoc" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2408" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "CoVoc Coronavirus Vocabulary" ; rdfs:subClassOf obo:MI_0473 . obo:MI_2409 obo:IAO_0000115 """The Plant Ontology is a structured vocabulary and database resource that links plant anatomy, morphology and growth and development to plant genomics data. https://www.ebi.ac.uk/ols/ontologies/po""" ; oboInOwl:created_by "Licata" ; oboInOwl:hasExactSynonym "PO", "plant ontology" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2409" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "Plant Ontology" ; rdfs:subClassOf obo:MI_0473 . obo:MI_2410 obo:IAO_0000115 """A semi-automatically constructed ontology that merges in multiple disease resources to yield a coherent merged ontology. https://www.ebi.ac.uk/ols/ontologies/mondo""" ; oboInOwl:created_by "Licata" ; oboInOwl:creation_date "2022-06-30T16:05:45Z" ; oboInOwl:hasExactSynonym "mondo" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2410" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "mondo" ; rdfs:subClassOf obo:MI_0473 . obo:MI_2411 obo:IAO_0000115 "The protein of interest is expressed as a fusion to a MAC-tag, which contains a twin-strep affinity tag and BirA* in one construct, requires generation of only one isogenic cell line and allows one-step protein purification by Strep-Tactin matrix for both AP–MS and BioID pipelines." ; oboInOwl:created_by "Licata" ; oboInOwl:creation_date "2022-07-28T16:04:45Z" ; oboInOwl:hasExactSynonym "mac-tag" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2411" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "mac tag" ; rdfs:subClassOf obo:MI_0507 . obo:MI_2412 obo:IAO_0000115 "Protein complementation methods specifically developed to assay for interactions of membrane proteins with both cytosolic or membrane-bound partners." ; oboInOwl:created_by "Licata" ; oboInOwl:creation_date "2022-02-03T16:27:45Z" ; oboInOwl:hasExactSynonym "MTH" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2412" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "membrane two hybrid" ; rdfs:subClassOf obo:MI_0232 . obo:MI_2413 obo:IAO_0000115 "A membrane bait protein is tagged with the C-terminal half of ubiquitin (Cub) and a chimeric transcription factor, and a cytosolic or membrane-bound prey is tagged with the N-terminal half of ubiquitin (Nub). Upon interaction of bait and prey, the split halves form pseudoubiquitin, which is recognized by cytosolic deubiquitinating enzymes, resulting in cleavage of the transcription factor and expression of a reporter gene." ; oboInOwl:created_by "Licata" ; oboInOwl:creation_date "2023-02-03T10:18:35Z" ; oboInOwl:hasExactSynonym "MAMTH" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2413" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "mammalian membrane two hybrid" ; rdfs:subClassOf obo:MI_0112 . obo:MI_2414 obo:IAO_0000115 "The Cellosaurus is a knowledge resource on cell lines. It aims to describe all cell lines used in biomedical research." ; oboInOwl:created_by "Licata" ; oboInOwl:creation_date "2023-02-04T11:18:35Z" ; oboInOwl:hasExactSynonym "cellosaurus" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2414" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "Cellosaurus" ; rdfs:subClassOf obo:MI_0473 . obo:MI_2415 obo:IAO_0000115 "The Cell Line Ontology (CLO) is a community-based ontology of cell lines. The CLO is developed to unify publicly available cell line entry data from multiple sources to a standardized logically defined format based on consensus design patterns." ; oboInOwl:created_by "Licata" ; oboInOwl:creation_date "2023-02-04T11:50:35Z" ; oboInOwl:hasExactSynonym "CLO", "Cell Line Ontology" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2415" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "cell line ontology" ; rdfs:subClassOf obo:MI_0473 . obo:MI_2416 obo:IAO_0000115 """Ensembl Bacteria is a browser for bacterial and archaeal genomes. https://bacteria.ensembl.org/""" ; oboInOwl:created_by "Licata" ; oboInOwl:creation_date "2023-02-04T12:00:05Z" ; oboInOwl:hasExactSynonym "Ensembl Bacteria", "ensembl bacteria" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2416" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "ensemblbacteria" ; rdfs:subClassOf obo:MI_1013 . obo:MI_2417 obo:IAO_0000115 "Ensembl Fungi is a browser for fungal genomes. https://fungi.ensembl.org/" ; oboInOwl:created_by "Licata" ; oboInOwl:creation_date "2023-02-04T12:10:25Z" ; oboInOwl:hasExactSynonym "Ensembl Fungi", "ensembl fungi" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2417" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "ensemblfungi" ; rdfs:subClassOf obo:MI_1013 . obo:MI_2418 obo:IAO_0000115 "Ensembl Metazoa is a is a browser for genomes of metazoan species of scientific interest. https://metazoa.ensembl.org/" ; oboInOwl:created_by "Licata" ; oboInOwl:creation_date "2023-02-04T12:20:05Z" ; oboInOwl:hasExactSynonym "Ensembl Metazoa", "ensembl metazoa" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2418" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "ensemblmetazoa" ; rdfs:subClassOf obo:MI_1013 . obo:MI_2419 obo:IAO_0000115 """Ensembl Plants is a browser for plant genomes. https://plants.ensembl.org/""" ; oboInOwl:created_by "Licata" ; oboInOwl:creation_date "2023-02-04T12:33:15Z" ; oboInOwl:hasExactSynonym "Ensembl Plants", "ensembl plants" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2419" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "ensemblplants" ; rdfs:subClassOf obo:MI_1013 . obo:MI_2420 obo:IAO_0000115 "Ensembl Protists is a browser for protist genomes. https://protists.ensembl.org/" ; oboInOwl:created_by "Licata" ; oboInOwl:creation_date "2023-02-04T12:40:07Z" ; oboInOwl:hasExactSynonym "Ensembl Protists", "ensembl protists" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2420" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "ensemblprotists" ; rdfs:subClassOf obo:MI_1013 . obo:MI_2421 obo:IAO_0000115 """SubtiList is the reference database dedicated to the genome of Bacillus subtilis, the paradigm of Gram-positive endospore-forming bacteria. http://genolist.pasteur.fr/SubtiList/""" ; oboInOwl:created_by "Licata" ; oboInOwl:hasExactSynonym "Subtilist" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2421" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "subtilist" ; rdfs:subClassOf obo:MI_1094 . obo:MI_2422 obo:IAO_0000115 "Mass photometry measures mass at the single molecule level in solution and enables the quantification of protein–protein interactions in solution with sufficient sensitivity to accurately determine stoichiometry and rate of reactions." ; oboInOwl:created_by "Licata" ; oboInOwl:creation_date "2023-19-07T11:19:50Z" ; oboInOwl:hasExactSynonym "mass photometry" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2422" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "mass photometry" ; rdfs:subClassOf obo:MI_0067 . obo:MI_2424 obo:IAO_0000115 """HuMap is a a machine learning framework to identify protein complexes from mass spectrometry and other large-scale interaction experiments. HuMap 2.0 is presented as a searchable web resource (http://humap2.proteincomplexes.org/) using data from 15,000 mass spectrometry experiments to identify nearly 7,000 physical assemblies. HuMap3.0 is in preparation. https://humap2.proteincomplexes.org/""" ; oboInOwl:created_by "Licata" ; oboInOwl:hasExactSynonym "HuMap" ; oboInOwl:id "MI:2424" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "HuMap"@en ; rdfs:subClassOf obo:MI_0489 . obo:MI_2425 obo:IAO_0000115 """A web-resource (https://www.proteomehd.net/index) that provides a co-regulation map of the human proteome built from ProteomeHD data (5,288 individual mass spectrometry experiments) and datasets from the Proteomics Identifications dataset using the machine learning algorithm treeClust to identify functional associations between co-regulated human proteins. https://www.proteomehd.net/proteomehd""" ; oboInOwl:created_by "Licata" ; oboInOwl:creation_date "2024-07-08T10:27:01Z" ; oboInOwl:hasExactSynonym "ProteomeHD" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2425" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "ProteomeHD"@en ; rdfs:subClassOf obo:MI_1336 . obo:MI_2426 obo:IAO_0000115 "Reference to an orthology database group. Gathers orthologous entities across species in a single identifier for their group" ; oboInOwl:created_by "Licata" ; oboInOwl:hasExactSynonym "orthology-group" ; oboInOwl:hasOBONamespace "PSI-MI" ; oboInOwl:id "MI:2426" ; oboInOwl:inSubset mi:PSI-MI_slim ; a owl:Class ; rdfs:label "orthology-group"@en ; rdfs:subClassOf obo:MI_0353 . mi:DeltaMass-label oboInOwl:hasScope oboInOwl:hasExactSynonym ; a owl:AnnotationProperty ; rdfs:label "Label from MS DeltaMass" ; rdfs:subPropertyOf oboInOwl:SynonymTypeProperty . mi:Drugable a owl:AnnotationProperty ; rdfs:comment "Drugable Genome Project" ; rdfs:subPropertyOf oboInOwl:SubsetProperty . mi:PSI-MI-alternate oboInOwl:hasScope oboInOwl:hasExactSynonym ; a owl:AnnotationProperty ; rdfs:label "Alternate label curated by PSI-MI" ; rdfs:subPropertyOf oboInOwl:SynonymTypeProperty . mi:PSI-MI-short oboInOwl:hasScope oboInOwl:hasExactSynonym ; a owl:AnnotationProperty ; rdfs:label "Unique short label curated by PSI-MI" ; rdfs:subPropertyOf oboInOwl:SynonymTypeProperty . mi:PSI-MI_slim a owl:AnnotationProperty ; rdfs:comment "Subset of PSI-MI" ; rdfs:subPropertyOf oboInOwl:SubsetProperty . mi:PSI-MOD-alternate oboInOwl:hasScope oboInOwl:hasExactSynonym ; a owl:AnnotationProperty ; rdfs:label "Alternate label curated by PSI-MOD" ; rdfs:subPropertyOf oboInOwl:SynonymTypeProperty . mi:PSI-MOD-short oboInOwl:hasScope oboInOwl:hasExactSynonym ; a owl:AnnotationProperty ; rdfs:label "Unique short label curated by PSI-MOD" ; rdfs:subPropertyOf oboInOwl:SynonymTypeProperty . mi:PSI-MOD_slim a owl:AnnotationProperty ; rdfs:comment "subset of protein modifications" ; rdfs:subPropertyOf oboInOwl:SubsetProperty . mi:PSI-MS-label oboInOwl:hasScope oboInOwl:hasRelatedSynonym ; a owl:AnnotationProperty ; rdfs:label "Agreed label from MS community" ; rdfs:subPropertyOf oboInOwl:SynonymTypeProperty . mi:RESID-alternate oboInOwl:hasScope oboInOwl:hasExactSynonym ; a owl:AnnotationProperty ; rdfs:label "Alternate name from RESID" ; rdfs:subPropertyOf oboInOwl:SynonymTypeProperty . mi:RESID-misnomer oboInOwl:hasScope oboInOwl:hasRelatedSynonym ; a owl:AnnotationProperty ; rdfs:label "Misnomer label from RESID" ; rdfs:subPropertyOf oboInOwl:SynonymTypeProperty . mi:RESID-name oboInOwl:hasScope oboInOwl:hasExactSynonym ; a owl:AnnotationProperty ; rdfs:label "Name from RESID" ; rdfs:subPropertyOf oboInOwl:SynonymTypeProperty . mi:RESID-systematic oboInOwl:hasScope oboInOwl:hasExactSynonym ; a owl:AnnotationProperty ; rdfs:label "Systematic name from RESID" ; rdfs:subPropertyOf oboInOwl:SynonymTypeProperty . mi:UniMod-alternate oboInOwl:hasScope oboInOwl:hasRelatedSynonym ; a owl:AnnotationProperty ; rdfs:label "Alternate name from UniMod" ; rdfs:subPropertyOf oboInOwl:SynonymTypeProperty . mi:UniMod-description oboInOwl:hasScope oboInOwl:hasRelatedSynonym ; a owl:AnnotationProperty ; rdfs:label "Description (full_name) from UniMod" ; rdfs:subPropertyOf oboInOwl:SynonymTypeProperty . mi:UniMod-interim oboInOwl:hasScope oboInOwl:hasRelatedSynonym ; a owl:AnnotationProperty ; rdfs:label "Interim label from UniMod" ; rdfs:subPropertyOf oboInOwl:SynonymTypeProperty . mi:UniMod-label oboInOwl:hasScope oboInOwl:hasRelatedSynonym ; a owl:AnnotationProperty ; rdfs:label "Label (title) from UniMod" ; rdfs:subPropertyOf oboInOwl:SynonymTypeProperty . mi:UniProt-feature oboInOwl:hasScope oboInOwl:hasExactSynonym ; a owl:AnnotationProperty ; rdfs:label "Protein feature description from UniProtKB" ; rdfs:subPropertyOf oboInOwl:SynonymTypeProperty . mi:isDefinedBy a owl:AnnotationProperty . oboInOwl:auto-generated-by "OBO-Edit 2.3.1" ; oboInOwl:date "15:04:2021 22:57" ; oboInOwl:default-namespace "PSI-MI" ; oboInOwl:hasOBOFormatVersion "1.2" ; oboInOwl:saved-by "pporras" ; a owl:Ontology ; rdfs:comment "CVversion: 2.5.5", "Each of the top level terms in this file is the root term of an independent controlled vocabulary", "Notes:", "The PSI MI schema defines short labels for controlled vocabulary terms", "The correct use of these vocabularies in the PSI Molecular Interaction XML schema is", "The last accession number used in this file is stored in a separate file,", "The maintenance of this file is ensured by Luana Licata luana.licata@uniroma2.it and Sandra Orchard orchard@ebi.ac.uk", "coverage: This file collect controlled vocabularies describing different aspects of molecular interactions.", "formalized in a mapping file available at http://www.psidev.info/files/validator/xml/MI-CVMapping.xml.", "mapping an element of the PSI Molecular Interaction XML schema.", "psi-mi.lastac. It MUST be updated when this file is updated.", "publisher: This file is published by the PSI MI working group see http://psidev.info/MI", "short labels are reported as PSI-MI-short synonyms that are created when a term is more than 20 characteres long." . oboInOwl:SubsetProperty a owl:AnnotationProperty ; rdfs:label "subset_property" . oboInOwl:SynonymTypeProperty a owl:AnnotationProperty ; rdfs:label "synonym_type_property" . oboInOwl:auto-generated-by a owl:AnnotationProperty . oboInOwl:created_by a owl:AnnotationProperty . oboInOwl:creation_date a owl:AnnotationProperty . oboInOwl:date a owl:AnnotationProperty . oboInOwl:default-namespace a owl:AnnotationProperty . oboInOwl:hasAlternativeId a owl:AnnotationProperty ; rdfs:label "has_alternative_id" . oboInOwl:hasBroadSynonym a owl:AnnotationProperty ; rdfs:label "has_broad_synonym" . oboInOwl:hasDbXref a owl:AnnotationProperty ; rdfs:label "database_cross_reference" . oboInOwl:hasExactSynonym a owl:AnnotationProperty ; rdfs:label "has_exact_synonym" . oboInOwl:hasNarrowSynonym a owl:AnnotationProperty ; rdfs:label "has_narrow_synonym" . oboInOwl:hasOBOFormatVersion a owl:AnnotationProperty ; rdfs:label "has_obo_format_version" . oboInOwl:hasOBONamespace a owl:AnnotationProperty ; rdfs:label "has_obo_namespace" . oboInOwl:hasRelatedSynonym a owl:AnnotationProperty ; rdfs:label "has_related_synonym" . oboInOwl:hasScope a owl:AnnotationProperty ; rdfs:label "has_scope" . oboInOwl:hasSynonymType a owl:AnnotationProperty ; rdfs:label "has_synonym_type" . oboInOwl:id a owl:AnnotationProperty . oboInOwl:inSubset a owl:AnnotationProperty ; rdfs:label "in_subset" . oboInOwl:saved-by a owl:AnnotationProperty . rdfs:comment a owl:AnnotationProperty . rdfs:label a owl:AnnotationProperty . owl:deprecated a owl:AnnotationProperty . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0000 ; owl:annotatedTarget "Controlled vocabularies originally created for protein protein interactions, extended to other molecules interactions." . [] oboInOwl:hasDbXref "PMID:7708014" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0004 ; owl:annotatedTarget "This class of approaches is characterised by the use of affinity resins as tools to purify molecule of interest (baits) and their binding partners. The baits can be captured by a variety of high affinity ligands linked to a resin - for example, antibodies specific for the bait itself, antibodies for specific tags engineered to be expressed as part of the bait or other high affinity binders such as glutathione resins for GST fusion proteins, metal resins for histidine-tagged proteins." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0045 ; owl:annotatedTarget "Methods based on laboratory experiments to determine an interaction." . [] oboInOwl:hasDbXref "PMID:14577292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0380 ; owl:annotatedTarget "Molecules labelled with isotope 15 of nytrogen atoms." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0380 ; owl:annotatedTarget "15N" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0380 ; owl:annotatedTarget "N15" . [] oboInOwl:hasDbXref "PMID:14577292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0381 ; owl:annotatedTarget "Molecules labelled with isotope 2 of hydrogen atoms." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0381 ; owl:annotatedTarget "2H2" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0381 ; owl:annotatedTarget "D2" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0381 ; owl:annotatedTarget "deuterium" . [] oboInOwl:hasDbXref "PMID:14577292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0382 ; owl:annotatedTarget "Region of a molecule whose mutation or deletion increases significantly interaction strength or rate (in the case of interactions inferred from enzymatic reaction)." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0382 ; owl:annotatedTarget "mutation increasing" . [] oboInOwl:hasDbXref "PMID:14577292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0383 ; owl:annotatedTarget "Molecule consisting of a specific sequence of amino acidic or nucleotidic monomers strung together through chemical bonds." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0046 ; owl:annotatedTarget "Predictive algorithms that rely on the information obtained by experimental results." . [] oboInOwl:hasDbXref "PMID:10449539" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0384 ; owl:annotatedTarget "All Alexa dyes are fluorescent iodoacetamide dyes that can be conjugated with the primary amines of biomolecules. All Alexa dyes and their conjugates are more fluorescent and more photostable than the commonly used dyes. The numbers in the Alexa names indicate the approximate excitation wavelength maximum in nm)." . [] oboInOwl:hasDbXref "PMID:10449539" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0385 ; owl:annotatedTarget "Alexa fluorescent dye analogue to AMCA (7-amino-4-methylcoumarin-3-acetic acid) with an approximate excitation wavelength maximum of 350 nm." . [] oboInOwl:hasDbXref "PMID:10449539" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0386 ; owl:annotatedTarget "Alexa fluorescent dye analogue to Lucifer Yellow with an approximate excitation wavelength maximum of 430 nm." . [] oboInOwl:hasDbXref "PMID:10449539" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0387 ; owl:annotatedTarget "Alexa fluorescent dye analogue to Oregon Green 488 with an approximate excitation wavelength maximum of 488 nm." . [] oboInOwl:hasDbXref "PMID:10449539" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0388 ; owl:annotatedTarget "Alexa fluorescent dye analogue to Rhodamine 6G with an approximate excitation wavelength maximum of 532nm." . [] oboInOwl:hasDbXref "PMID:10449539" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0389 ; owl:annotatedTarget "Alexa fluorescent dye analogue to Cy3 with an approximate excitation wavelength maximum of 546nm." . [] oboInOwl:hasDbXref "PMID:10449539" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0390 ; owl:annotatedTarget "Alexa fluorescent dye analogue to Rhodamine Red-X with an approximate excitation wavelength maximum of 568nm." . [] oboInOwl:hasDbXref "PMID:10449539" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0391 ; owl:annotatedTarget "Alexa fluorescent dye analogue to Texas Red-X with an approximate excitation wavelength maximum of 594nm." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0396 ; owl:annotatedTarget "Molecule whose sequence identity is not checked and has been assumed from external or previous experimental evidence(s)." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0396 ; owl:annotatedTarget "predetermined" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0046 ; owl:annotatedTarget "experimental info" . [] oboInOwl:hasDbXref "PMID:10688190", "PMID:11827624" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0397 ; owl:annotatedTarget "Two-hybrid screening can be done in a colony array format, in which each colony expresses a defined pair of proteins. Because the particular protein pair expressed in each colony is defined by its position in the array, positive signals identify interacting proteins without further characterization, thus obviating the need for DNA purification and sequencing. The interrogation of a two-hybrid colony array usually involves a mating strategy in which every DNA binding domain hybrid (the bait) is tested against all activation domain hybrids (the preys) in a grid pattern. Arrays usually use full-length open reading frames." . [] oboInOwl:hasDbXref "PMID:11283351", "PMID:20946815" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0398 ; owl:annotatedTarget "In the pooling strategy sets of either both bait and prey hybrid vectors are mated or, more commonly, individual baits are mated against pools of preys. This approach required cloning baits and preys into both two-hybrid vectors, followed by pooling sets of transformants. The positive double hybrid clones are the interacting partners. The pooling of both baits and prey molecules is now a rarely used technique as the pooling of baits often leads to misleading results." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0398 ; owl:annotatedTarget "two hybrid pooling" . [] oboInOwl:hasDbXref "PMID:12634794" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0399 ; owl:annotatedTarget "Individual baits are mated against pools of random fragmented preys. The usage of degenerated fragment allows identification of the minimal protein region required for the interaction. Since multiple clones that encode overlapping regions of protein are often identified, the minimal domain for interaction may be readily apparent from the initial screen." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0399 ; owl:annotatedTarget "2h fragment pooling" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0400 ; owl:annotatedTarget "Techniques which depend upon the strength of the interaction between two entities." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0400 ; owl:annotatedTarget "affinity techniques" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0401 ; owl:annotatedTarget "The application of chemical principles and methods to biological experiments to demonstrate an interaction." . [] oboInOwl:hasDbXref "PMID:12054902" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0402 ; owl:annotatedTarget "Chromatin immunoprecipitation (ChIP) is a powerful approach that allows one to define the interaction of factors with specific chromosomal sites in living cells. An antibody against a protein suspected of binding a given cis-element is used to immunoprecipitate fragmented chromatin fragments. Cells or tissue may first be briefly treated with an agent such formaldehyde to crosslink proteins to DNA. Nucleic acids are then identified by sequencing, for example polymerase chain reaction analysis of the immunoprecipitate with primers flanking the cis-element or next-generation sequencing techniques" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0402 ; owl:annotatedTarget "ch-ip" . [] oboInOwl:hasDbXref "PMID:7708014" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0047 ; owl:annotatedTarget "Proteins are fractionated by PAGE (SDS-polyacrylamide gel electrophoresis), transferred to a nitrocellulose membrane and tested for the ability to bind to a protein, a peptide, or any other ligand. Cell lysates can also be fractionated before gel electrophoresis to increase the sensitivity of the method for detecting interactions with rare proteins. Denaturants are removed during the blotting procedure, which allows many proteins to recover (or partially recover) activity. However, if biological activity is not recoverable, the proteins can be fractionated by a non denaturing gel system. This variation of the method eliminates the problem of activity regeneration and allows the detection of binding when the presence of a protein complex is required for binding. The protein probe can be prepared by any one of several procedures, while fusion affinity tags greatly facilitate purification. Synthesis in E. coli with a GST fusion, epitope tag, or other affinity tag is most commonly used. The protein of interest can then be radioactively labelled, biotinylated, or used in the blotting procedure as an unlabeled probe that is detected by a specific antibody." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0403 ; owl:annotatedTarget "Coincident occurrence of molecules in a given subcellular fraction observed with a low resolution methodology from which a physical interaction among those molecules cannot be inferred." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0404 ; owl:annotatedTarget "A method allowing the detection of strong interactions between two or more molecules as running, all of them, within a single band in a non-denaturing gel." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0404 ; owl:annotatedTarget "comig non denat gel" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0405 ; owl:annotatedTarget "Competitive binding experiments measure equilibrium binding of a single concentration of ligand at various concentrations of an unlabeled competitor. Analysis of these data gives the affinity of the receptor for the competitor." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0406 ; owl:annotatedTarget "Measures the catalysis of the hydrolysis of an acetyl group or groups from a substrate molecule." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0407 ; owl:annotatedTarget "Interaction between molecules that are in direct contact with each other." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0408 ; owl:annotatedTarget "Covalent bond mediated by 2 sulfur atoms." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0408 ; owl:annotatedTarget "SS-bond" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0408 ; owl:annotatedTarget "disulfide bridge" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0409 ; owl:annotatedTarget """Experimental method used to identify the region of a nucleic acid involved in an interaction with a protein. One sample of a radiolabeled nucleic acid of known sequence is submitted to partial digestion. A second sample is incubated with its interacting partner and then is submitted to the same partial digestion. The two samples are then analyzed in parallel by electrophoresis on a denaturing acrylamide gel. After autoradiography the identification of the bands that correspond to fragments missing from the lane loaded with the second sample reveals the region of the nucleic acid that is protected from nuclease digestion upon binding. OBSOLETE because redundant with MI:0417 'footprinting' combined with interactor type MI:0319 'DNA' replace by:MI:0417""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0047 ; owl:annotatedTarget "Affinity blotting" . [] oboInOwl:hasDbXref "PMID:12160704" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0410 ; owl:annotatedTarget "Three-dimensional (3D) reconstruction of single, transparent objects from a collection of projection images recorded with a transmission electron microscope. It offers the opportunity to obtain 3D information on structural cellular arrangements with a high resolution." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0410 ; owl:annotatedTarget "3D-EM" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0410 ; owl:annotatedTarget "electron tomog" . [] oboInOwl:hasDbXref "PMID:11906746" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0411 ; owl:annotatedTarget "Following non-covalent binding of a purified primary ligand to a solid phase, a blocking reagent is added to prevent any non-specific binding. A specific antigen is then allowed to bind to the primary ligand. Unbound antigen is removed by washing and a secondary antibody conjugated to an enzyme (e.g. horseradish peroxidase) is added. Following a washing step to remove unbound secondary ligand, the extent to which a chromogenic substrate (e.g. 3,3', 5,5' tetramethyl benzidine chromogen [TMB]) is converted to a soluble coloured product by the conjugated enzyme in a given time is determined by spectrophotometry using a standard microplate absorbance reader. A similar type of approach can be utilized to detect enzymatic activities. The substrate, attached to a solid phase is incubated in the presence of the enzyme and the enzymatic modification is monitored by an antibody that is specific for the modified substrate (for instance a phosphorylated protein)." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0411 ; owl:annotatedTarget "ELISA" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0411 ; owl:annotatedTarget "elisa" . [] oboInOwl:hasDbXref "PMID:12169687" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0412 ; owl:annotatedTarget "The EMSA supershift is a EMSA experiment carried out using a third lane loaded with the radiolabeled nucleic acid, a protein mixture and an antibody for a specific protein. If an extra retardation is observed, this is due to the formation of a larger complex including the antibody. By this approach, at least one protein of the complex is directly identified." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0412 ; owl:annotatedTarget "emsa supershift" . [] oboInOwl:hasDbXref "PMID:12169687" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0413 ; owl:annotatedTarget "This method proves the interaction between a nucleic acid and a protein partner. On the same electrophoresis gel 1 lane is loaded with a nucleic acid of known sequence, a second lane is loaded with the same nucleic acid together with a purified protein (or a protein mixture). The nucleic acid is often radio-labelled to enable visualisation by autoradiography. Comparison of the nucleic acid migration in the two lanes enables the retardation of the nucleic acid due to its interaction with a protein to be observed." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0413 ; owl:annotatedTarget "Gel retardation assay" . [] oboInOwl:hasDbXref "PMID:7682645" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0048 ; owl:annotatedTarget "Filamentous phages (M13, f1, fd) have been extensively used to develop and implement the technology of phage display. Repertoires of relatively short peptides of random amino acid sequences or cDNA libraries have been constructed and searched successfully. Most experiments have taken advantage of the ability to assemble phages decorated with hybrid versions of the receptor protein pIII or of the major coat protein pVIII. Both systems allow the display of foreign peptides by fusion to the amino-terminus of the capsid protein but differ in the number of peptide copies that can be displayed on each phage particle. Display libraries of very diverse protein fragments have been constructed by fusing either genomic or cDNA fragments to gene III or gene VIII." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0413 ; owl:annotatedTarget "band shift" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0413 ; owl:annotatedTarget "emsa" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0414 ; owl:annotatedTarget "terms aiming to represent biochemical reactions referring to their resulting product modifications." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0414 ; owl:annotatedTarget "Biochemical reaction" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0415 ; owl:annotatedTarget "Participants are enzyme or substrate in a biochemical reaction." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0416 ; owl:annotatedTarget "Fluorescent microscopy uses a high intensity light to illuminate the sample. This light excites fluorescence species in the sample, which then emit light of a longer wavelength. A fluorescent microscope also produces a magnified image of the sample, but the image is based on the second light source -- the light emanating from the fluorescent species -- rather than from the light originally used to illuminate, and excite, the sample." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0416 ; owl:annotatedTarget "fluorescence imaging" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0417 ; owl:annotatedTarget "Footprinting analysis is used to identify regions of molecules involved in binding other macromolecules and therefore protected from the effects of degradative enzymes, chemical treatment or other deleterious treatments." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0418 ; owl:annotatedTarget """methods supporting genetic interactions. OBSOLETE as too unspecific use Genetic interference instead MI:0254.""" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0419 ; owl:annotatedTarget "Measures the catalysis of the reaction: GTP + H2O = GDP + phosphate." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0048 ; owl:annotatedTarget "filamentous phage" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0419 ; owl:annotatedTarget "GTPase" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0419 ; owl:annotatedTarget "gtp hydrolisis" . [] oboInOwl:hasDbXref "PMID:14987100" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0420 ; owl:annotatedTarget "Measures quenching of the nonradiative energy transfer between fluorescent long-lifetime lanthanide chelates and different acceptors. Relies on a fluorescence energy donor and acceptor being added from close proximity on the phosphorylated substrate due to the action of the kinase." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0420 ; owl:annotatedTarget "homogeneous time-resolved fluorescence" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0420 ; owl:annotatedTarget "kinase HTRF" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0420 ; owl:annotatedTarget "kinase htrf" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0421 ; owl:annotatedTarget "Antibody mediated participant identification." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0421 ; owl:annotatedTarget "antibody detection" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0422 ; owl:annotatedTarget "Method using an antibody coupled with some colouring agent to detect a specific protein within a cell or tissue sample. In some cases the primary antibody is directly linked to a colouring agent, more often the primary antibody is targeted by a secondary antibody, targeting the primary antibody." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0423 ; owl:annotatedTarget "Substrate protein radio-labelled by kinase transferring an isotope of phosphate from the nucleotide. Substrate isolated by gel electrophoresis and radio-labelling confirmed by autoradiography." . [] oboInOwl:hasDbXref "PMID:7708014" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0049 ; owl:annotatedTarget "A method in which separation depends upon the ability of one participant to bind to a filter or membrane which the other participants do not. Molecules interacting with the bound molecule will also be retain on the filter. For example, proteins expressed by different clones of an expression library are bound to a nitrocellulose membrane, by colony (bacterial library) or plaque (phage library) blotting. A labelled protein can then be used as a probe to identify clones expressing proteins that interact with the probe. Interactions occur on the nitrocellulose filters. The method is highly general and therefore widely applicable. A variety of approaches can be used to label the ligand, alternatively the ligand can be detected by a specific antibody." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0423 ; owl:annotatedTarget "in gel kinase assay" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0424 ; owl:annotatedTarget "Catalysis of the transfer of a phosphate group, usually from ATP, to a protein substrate." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0425 ; owl:annotatedTarget "Relies on the radiolabelling of a peptide substrate immobilized on a scintillant coated SPA-bead. The kinase transfers a phosphate isotope from the nucleotide to the substrate." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0425 ; owl:annotatedTarget "kinase spa" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0426 ; owl:annotatedTarget "Light visible microscopy uses environmental light to illuminate the sample and produce a magnified image of the sample." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0427 ; owl:annotatedTarget "identification by mass spectrometry." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0427 ; owl:annotatedTarget "ms participant" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0428 ; owl:annotatedTarget "Methods that provide images of molecules at various resolution depending on the technology used." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0428 ; owl:annotatedTarget "microscopy" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0429 ; owl:annotatedTarget "A sequence range within a molecule identified as being absolutely required for an interaction. The sequence may or may not be in direct physical contact with the interaction partner." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0049 ; owl:annotatedTarget "Filter overlay assay" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0429 ; owl:annotatedTarget "required to bind" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0430 ; owl:annotatedTarget "Nucleic acids are incubated with purified proteins or a protein mixture and then exposed to a chemical cross-linking agent that may be activated by UV light exposure. The eventual complexes can be identified by sequencing or autoradiography if the nucleic acid is radio-labelled and the sequence is known. The proteins involved in the complex can be recognized by specific antibodies or by retrieving the original protein mixture and carrying further analysis on it." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0430 ; owl:annotatedTarget "nucl ac uv crosslink" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0431 ; owl:annotatedTarget """Deprecated terms. OBSOLETE term replaced by the default OBO class 'Obsolete'.""" . [] oboInOwl:hasDbXref "PMID:10589421" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0432 ; owl:annotatedTarget "Protein-DNA complementation assay where a single promoter act as bait and is screened against a library of prey transcription factors." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0432 ; owl:annotatedTarget "1 hybrid" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0432 ; owl:annotatedTarget "one-hybrid" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0432 ; owl:annotatedTarget "yeast one hybrid" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0432 ; owl:annotatedTarget "yeast one-hybrid" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0433 ; owl:annotatedTarget "partial protein sequence identification." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0050 ; owl:annotatedTarget """The protein of interest is expressed as a fusion to the peptide DYKDDDDKV for which antibodies are commercially available. Sometimes multiple copies of the peptide are fused in tandem. OBSOLETE redundant term. Map to feature type: flag-tagged (MI:0518) and Interaction detection method: anti tag coimmunoprecipitation (MI:0007).""" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0433 ; owl:annotatedTarget "partial id prot seq" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0434 ; owl:annotatedTarget "Measures the catalysis of the reaction: a phosphosubstrate + H2O = a substrate + phosphate." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0435 ; owl:annotatedTarget "Measures the enzymatic hydrolysis of a peptide bond within a peptide or protein substrate." . [] oboInOwl:hasDbXref "PMID:14600024", "PMID:14967031", "PMID:14987073" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0436 ; owl:annotatedTarget "Protein footprinting is a technique for identifying structural changes modulated by protein-ligand binding, and mapping protein-ligand interfaces This technique involves attaching cutting reagents randomly to amino acid residue (e.g. lysine or cysteine) on the proteins surface and then using this lysine-labelled protein to cleave polypeptide backbone of the other protein at exposed residues adjacent to its binding site." . [] oboInOwl:hasDbXref "PMID:12052864", "PMID:12761205", "PMID:12935900" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0437 ; owl:annotatedTarget "Two hybrid assay performed with a third protein component co-transfected into a recombinant yeast strain together with a bait and a prey construct. Negative control shows that the interaction between the bait and the prey do not occur when the third protein is not co-transfected." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0437 ; owl:annotatedTarget "bridge assay" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0437 ; owl:annotatedTarget "protein 3-hybrid" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0437 ; owl:annotatedTarget "protein tri hybrid" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0437 ; owl:annotatedTarget "trihybrid" . [] oboInOwl:hasDbXref "PMID:12162957", "PMID:8972875" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0438 ; owl:annotatedTarget "In vivo reconstruction of specific RNA-proteins interactions. The DNA binding and transcription activator domains of GAL4 are brought together via the interaction of recombinant RNA. The first hybrid protein contains the DNA binding domain of GAL4 fused to RevM10 (a mutated RNA binding protein of HIV-1 that binds specifically to the Rev responsive element RRE of the env gene). A recombinant RNA contains the RRE sequence and a target RNA sequence X. The second hybrid protein contains the activation domain of GAL4 fused to protein Y tested for its ability to bind the target RNA X. If this interaction occurs the three hybrid reconstructs GAL4 and the transcription of a reporter gene is activated." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0004 ; owl:annotatedTarget "Affinity purification" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0050 ; owl:annotatedTarget "flag tag coip" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0438 ; owl:annotatedTarget "Three hybrid system" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0438 ; owl:annotatedTarget "rna 3-hybrid" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0438 ; owl:annotatedTarget "rna tri hybrid" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0438 ; owl:annotatedTarget "rna-three hybrid" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0439 ; owl:annotatedTarget "A technique used to detect genetic interactions between 2 (or more) genes in a sporulating organism by scoring a large population of haploid spores for a phenotype and correlating the phenotype with the presence of single vs double (multiple) mutations. A diploid heterozygous organism harbouring mutations in two (or more) genes is induced to sporulate. Resulting spores are meiotic segregants that are haploid and are either wild type or mutant at each locus. Spores are scored for a phenotype, such as loss of viability." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0439 ; owl:annotatedTarget "RSA" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0439 ; owl:annotatedTarget "random-spore analysis" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0439 ; owl:annotatedTarget "rsa" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0439 ; owl:annotatedTarget "spore germination" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0440 ; owl:annotatedTarget "Saturation binding experiments measure specific ligand binding at equilibrium at various concentrations of the ligand. Analysis of these data can determine receptor number and affinity." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0051 ; owl:annotatedTarget "Techniques based upon the measurement of the emission of one or more photons by a molecule activated by the absorption of a quantum of electro-magnetic radiation. Typically the emission, which is characterised by a wavelength that is longer than the one of excitatory radiation, occurs within 10-8 seconds." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0441 ; owl:annotatedTarget "Identification of genetic interactions by generation of an organism harbouring mutations in 2 or more genes and scoring for a phenotype, such as loss of viability, that is not observed for any of the mutations in isolation." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0441 ; owl:annotatedTarget "SGA" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0441 ; owl:annotatedTarget "sga" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0442 ; owl:annotatedTarget "Binding will occur when this sequence range is present within a molecule or part of a molecule. This region will contain the direct binding region but may be longer." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0442 ; owl:annotatedTarget "sufficient to bind" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0443 ; owl:annotatedTarget """Interaction concerning ubiquitin that is covalently attached to any Lys residue of its interaction partner. OBSOLETE remap to ubiquitination reaction (MI:0220) or describe ubiquitine as a participant on the interaction using physical interaction (MI:0218) or covalent binding (MI:0195) as interaction type.""" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0444 ; owl:annotatedTarget "Database citation list names of databases commonly used to cross reference interaction data. http://purl.obolibrary.org/obo/clo.owl" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0445 ; owl:annotatedTarget "Databases acting as a source of literature information." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0445 ; owl:annotatedTarget "literature xref" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0445 ; owl:annotatedTarget "publication xref" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0051 ; owl:annotatedTarget "fluorescence" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0446 ; owl:annotatedTarget """PubMed is designed to provide access to citations from biomedical literature. The data can be found at both NCBI PubMed and Europe PubMed Central. http://www.ncbi.nlm.nih.gov/pubmed http://europepmc.org""" . [] a owl:Axiom ; rdfs:label "[0-9]+" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_0446 ; owl:annotatedTarget "id-validation-regexp:" . [] a owl:Axiom ; rdfs:label "http://europepmc.org/abstract/MED/${ac}" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_0446 ; owl:annotatedTarget "search-url:" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0447 ; owl:annotatedTarget "A database describing a feature on a molecule." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0447 ; owl:annotatedTarget "feature xref" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0448 ; owl:annotatedTarget """The objective of Gene Ontology (GO) is to provide controlled vocabularies for the description of the molecular function, biological process and cellular component of gene products. http://www.ebi.ac.uk/GO""" . [] a owl:Axiom ; rdfs:label "GO:[0-9]{7}" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_0448 ; owl:annotatedTarget "id-validation-regexp:" . [] a owl:Axiom ; rdfs:label "https://www.ebi.ac.uk/QuickGO/term/${ac}" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_0448 ; owl:annotatedTarget "search-url:" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0448 ; owl:annotatedTarget "go" . [] oboInOwl:hasDbXref "PMID:1252001" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0449 ; owl:annotatedTarget """InterPro combines a number of databases (referred to as member databases) that use different methodologies and a varying degree of biological information on well-characterised proteins to derive protein signatures that predict family membership and domain composition of naive protein sequences. https://www.ebi.ac.uk/interpro/""" . [] oboInOwl:hasDbXref "PMID:10733953" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0052 ; owl:annotatedTarget "FCS monitors the random motion of fluorescently labelled molecules inside a defined volume irradiated by a focused laser beam. These fluctuations provide information on the rate of diffusion or diffusion time of a particle and this is directly dependent on the particle mass. As a consequence, any increase in the mass of a biomolecule, e.g. as a result of an interaction with a second molecule, is readily detected as an increase in the diffusion time of the particle. From these results the concentration of the different molecules can be calculated as well as their binding constant." . [] a owl:Axiom ; rdfs:label "IPR[0-9]{6}" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_0449 ; owl:annotatedTarget "id-validation-regexp:" . [] a owl:Axiom ; rdfs:label "https://www.ebi.ac.uk/interpro/entry/InterPro/${ac}" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_0449 ; owl:annotatedTarget "search-url:" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0449 ; owl:annotatedTarget "InterPro" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0450 ; owl:annotatedTarget """The Conserved Domain Database may be used to identify the conserved domains present in a protein sequence. http://www.ncbi.nlm.nih.gov/Structure/cdd/cdd.shtml""" . [] a owl:Axiom ; rdfs:label "[0-9]+" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_0450 ; owl:annotatedTarget "id-validation-regexp:" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0450 ; owl:annotatedTarget "CDD" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0451 ; owl:annotatedTarget """Pfam is a large collection of multiple sequence alignments and hidden Markov models covering many common protein domains. http://www.sanger.ac.uk/Software/Pfam""" . [] a owl:Axiom ; rdfs:label "PF[0-9]{5}" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_0451 ; owl:annotatedTarget "id-validation-regexp:" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0451 ; owl:annotatedTarget "Pfam" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0452 ; owl:annotatedTarget """PIRSF is a classification system based on evolutionary relationship of whole proteins. http://pir.georgetown.edu/pirwww/dbinfo/pirsf.shtml""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0052 ; owl:annotatedTarget "FCS" . [] a owl:Axiom ; rdfs:label "PIRSF[0-9]{5}" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_0452 ; owl:annotatedTarget "id-validation-regexp:" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0452 ; owl:annotatedTarget "PIRSF" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0453 ; owl:annotatedTarget """PRINTS is a compendium of protein fingerprints. A fingerprint is a group of conserved motifs used to characterise a protein family. http://umber.sbs.man.ac.uk/dbbrowser/PRINTS/""" . [] a owl:Axiom ; rdfs:label "PR[0-9]{6}" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_0453 ; owl:annotatedTarget "id-validation-regexp:" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0453 ; owl:annotatedTarget "PRINTS" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0454 ; owl:annotatedTarget """The ProDom protein domain database consists of an automatic compilation of homologous domains. http://protein.toulouse.inra.fr/prodom.html""" . [] a owl:Axiom ; rdfs:label "PD[0-9]{6}" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_0454 ; owl:annotatedTarget "id-validation-regexp:" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0454 ; owl:annotatedTarget "ProDom" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0455 ; owl:annotatedTarget """PROSITE is a database of protein families and domains. It consists of biologically significant sites, patterns and profiles. http://us.expasy.org/prosite/""" . [] a owl:Axiom ; rdfs:label "PS[0-9]{5}" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_0455 ; owl:annotatedTarget "id-validation-regexp:" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0052 ; owl:annotatedTarget "fcs" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0455 ; owl:annotatedTarget "Prosite" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0456 ; owl:annotatedTarget """SUPERFAMILY is a library of profile hidden Markov models that represent all proteins of known structure. The library is based on the SCOP classification of proteins: each model corresponds to a SCOP domain. http://supfam.mrc-lmb.cam.ac.uk/SUPERFAMILY/""" . [] a owl:Axiom ; rdfs:label "[0-9]+" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_0456 ; owl:annotatedTarget "id-validation-regexp:" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0456 ; owl:annotatedTarget "SCOP superfamily" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0457 ; owl:annotatedTarget """SMART (a Simple Modular Architecture Research Tool) allows the identification and annotation of genetically mobile domains and the analysis of domain architectures. http://smart.embl-heidelberg.de/""" . [] a owl:Axiom ; rdfs:label "SM[0-9]{5}" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_0457 ; owl:annotatedTarget "id-validation-regexp:" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0457 ; owl:annotatedTarget "SMART" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0458 ; owl:annotatedTarget """TIGRFAMs is a collection of protein families, featuring curated multiple sequence alignments, Hidden Markov Models (HMMs) and annotation. http://www.tigr.org/TIGRFAMs""" . [] a owl:Axiom ; rdfs:label "TIGR[0-9]+" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_0458 ; owl:annotatedTarget "id-validation-regexp:" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0458 ; owl:annotatedTarget "TIGRFAMs" . [] oboInOwl:hasDbXref "PMID:12805227", "PMID:7708014" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0053 ; owl:annotatedTarget "Because of the long lifetimes of excited fluorescent molecules (nanoseconds), fluorescence can be used to monitor the rotational motion of molecules, which occurs on this timescale. This is accomplished experimentally by excitation with plane-polarized light, followed by measurement of the emission at parallel and perpendicular planes. Since rotational correlation times depend on the size of the molecule, this method can be used to measure the binding of two proteins because the observed polarization increase when a larger complex is formed. A fluorescence anisotropy experiment is normally carried out with a protein bearing a covalently added fluorescent group, which increases both the observed fluorescence lifetime of the excited state and the intensity of the fluorescent signal. Residue modification can be assessed by addition of an antibody which binds to the modified residue and alters the molecular weight of the complex. A variation of this technique has been used to show interaction of a DNA binding protein with another protein. In this case the DNA rather than protein is fluorescently labelled." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0459 ; owl:annotatedTarget """MMDB (Molecular Modeling DataBase), is a subset of three-dimensional structures obtained from the Protein Data Bank. http://www.ncbi.nlm.nih.gov/Structure""" . [] a owl:Axiom ; rdfs:label "[0-9]+" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_0459 ; owl:annotatedTarget "id-validation-regexp:" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0459 ; owl:annotatedTarget "MMDB" . [] oboInOwl:hasDbXref "PMID:14634627" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0460 ; owl:annotatedTarget """The RCSB PDB provides a variety of tools and resources for studying the structures of biological macromolecules and their relationships to sequence, function, and disease. http://www.pdb.org/""" . [] a owl:Axiom ; rdfs:label "[0-9][a-zA-Z0-9]{3}" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_0460 ; owl:annotatedTarget "id-validation-regexp:" . [] a owl:Axiom ; rdfs:label "http://www.pdb.org/pdb/explore/explore.do?structureId=${ac}" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_0460 ; owl:annotatedTarget "search-url:" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0460 ; owl:annotatedTarget "PDB" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0461 ; owl:annotatedTarget "Databases that contain experimental or predictive molecular interaction data." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0461 ; owl:annotatedTarget "interaction xref" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0462 ; owl:annotatedTarget """The Biomolecular Interaction Network Database (BIND) is a collection of records documenting molecular interactions. http://www.blueprint.org/bind""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0053 ; owl:annotatedTarget "FPS" . [] a owl:Axiom ; rdfs:label "[0-9]+" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_0462 ; owl:annotatedTarget "id-validation-regexp:" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0462 ; owl:annotatedTarget "BIND" . [] oboInOwl:hasDbXref "PMID:21071413" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0463 ; owl:annotatedTarget """The General Repository for Interaction Datasets (BioGRID) is a database of genetic and physical interactions. http://thebiogrid.org""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0463 ; owl:annotatedTarget "BioGRID" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0464 ; owl:annotatedTarget """The MIPS Comprehensive Yeast Genome Database (CYGD) aims to present information on the molecular structure and functional network of the entirely sequenced, well-studied model eukaryote, the budding yeast Saccharomyces cerevisiae. In addition the data of various projects on related yeasts are used for comparative analysis. http://mips.gsf.de/proj/yeast/CYGD. http://mips.gsf.de/genre/proj/mpact""" . [] a owl:Axiom ; rdfs:label "[0-9]+|[A-Z]{3}[0-9]{3}[A-Za-z](-[A-Za-z])?|[A-Z0-9]+\\.[0-9]+|YM[A-Z][0-9]{3}[a-z][0-9]" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_0464 ; owl:annotatedTarget "id-validation-regexp:" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0464 ; owl:annotatedTarget "CYGD" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0464 ; owl:annotatedTarget "CYGD (MIPS)" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0464 ; owl:annotatedTarget "MIPS" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0464 ; owl:annotatedTarget "MPact" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0053 ; owl:annotatedTarget "Fluorescence anisotropy" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0465 ; owl:annotatedTarget """The database of interacting protein (DIP) database stores experimentally determined interactions between proteins. It combines information from a variety of sources to create a single, consistent set of protein-protein interactions. http://dip.doe-mbi.ucla.edu/""" . [] a owl:Axiom ; rdfs:label "DIP[:-]?[0-9]+[NE]" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_0465 ; owl:annotatedTarget "id-validation-regexp:" . [] a owl:Axiom ; rdfs:label "http://identifiers.org/dip/${ac}" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_0465 ; owl:annotatedTarget "search-url:" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0465 ; owl:annotatedTarget "DIP" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0466 ; owl:annotatedTarget """EcoCyc is a bioinformatics database that describes the genome and the biochemical machinery of E. coli K12 MG1655. http://ecocyc.org/""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0466 ; owl:annotatedTarget "EcoCyc" . [] oboInOwl:hasDbXref "PMID:21067998" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0467 ; owl:annotatedTarget """The Reactome project is a collaboration among Cold Spring Harbor Laboratory, The European Bioinformatics Institute, and The Gene Ontology Consortium to develop a curated resource of core pathways and reactions in human biology. http://www.reactome.org/""" . [] a owl:Axiom ; rdfs:label "((R-[A-Z]{3}-\\d+)|(REACT_\\d+))(\\.\\d+)?$" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_0467 ; owl:annotatedTarget "id-validation-regexp:" . [] a owl:Axiom ; rdfs:label "http://www.reactome.org/content/detail/${ac}" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_0467 ; owl:annotatedTarget "search-url:" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0467 ; owl:annotatedTarget "GKB" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0053 ; owl:annotatedTarget "fps" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0467 ; owl:annotatedTarget "Genome Knowledge Base" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0467 ; owl:annotatedTarget "Reactome" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0468 ; owl:annotatedTarget """The Human Protein Reference Database represents a centralized platform to visually depict and integrate information pertaining to domain architecture, post-translational modifications, interaction networks and disease association for each protein in the human proteome. http://www.hprd.org/""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0468 ; owl:annotatedTarget "HPRD" . [] oboInOwl:hasDbXref "PMID:14681455", "PMID:19850723", "PMID:22121220" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0469 ; owl:annotatedTarget """INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact""" . [] a owl:Axiom ; rdfs:label "EBI-[0-9]+|IA:[0-9]+" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_0469 ; owl:annotatedTarget "id-validation-regexp:" . [] a owl:Axiom ; rdfs:label "http://www.ebi.ac.uk/intact/query/${ac}" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_0469 ; owl:annotatedTarget "search-url:" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0469 ; owl:annotatedTarget "IntAct" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0469 ; owl:annotatedTarget "intact" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0470 ; owl:annotatedTarget """KEGG (Kyoto Encyclopedia of Genes and Genomes) is a knowledge base for systematic analysis of gene functions, linking genomic information with higher order functional information and also supplies information about chemical compounds, enzyme molecules and enzymatic reactions. http://www.genome.ad.jp/kegg/""" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0004 ; owl:annotatedTarget "affinity chrom" . [] oboInOwl:hasDbXref "PMID:11988464" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0054 ; owl:annotatedTarget "Cells in suspension flow through a laser beam, the scattered light or emitted fluorescence is measured, filtered and converted to digital values. Cells can be sorted according to their properties. Using flow cytometry, any fluorescent or light scattering experiment can be carried out on entire cells. With this instrument, interactions occurring either on cell surfaces or in any other subcellular location can be studied by using suitable fluorescent labels." . [] a owl:Axiom ; rdfs:label "[a-zA-Z]+:[a-zA-Z]+[0-9]+" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_0470 ; owl:annotatedTarget "id-validation-regexp:" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0470 ; owl:annotatedTarget "KEGG" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0471 ; owl:annotatedTarget """The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it""" . [] a owl:Axiom ; rdfs:label "MINT-[0-9]+" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_0471 ; owl:annotatedTarget "id-validation-regexp:" . [] a owl:Axiom ; rdfs:label "https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac}" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_0471 ; owl:annotatedTarget "search-url:" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0471 ; owl:annotatedTarget "MINT" . [] oboInOwl:hasDbXref "PMID:16381867" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0472 ; owl:annotatedTarget """The Protein Data Bank in Europe - the European project for the collection, management and distribution of data about macromolecular structures, derived in part from the Protein Data Bank (PDB). http://www.ebi.ac.uk/pdbe/""" . [] a owl:Axiom ; rdfs:label "[0-9][a-zA-Z0-9]{3}" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_0472 ; owl:annotatedTarget "id-validation-regexp:" . [] a owl:Axiom ; rdfs:label "http://www.ebi.ac.uk/pdbe/entry/pdb/${ac}" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_0472 ; owl:annotatedTarget "search-url:" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0472 ; owl:annotatedTarget "PQS" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0054 ; owl:annotatedTarget "FACS" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0473 ; owl:annotatedTarget "Database of molecules participating in molecular interactions." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0473 ; owl:annotatedTarget "participant xref" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0474 ; owl:annotatedTarget """A definitive, freely available database of Chemical compounds of Biological Interest (ChEBI). http://www.ebi.ac.uk/chebi/""" . [] a owl:Axiom ; rdfs:label "CHEBI:[0-9]+" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_0474 ; owl:annotatedTarget "id-validation-regexp:" . [] a owl:Axiom ; rdfs:label "http://www.ebi.ac.uk/chebi/searchId.do?chebiId=${ac}" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_0474 ; owl:annotatedTarget "search-url:" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0474 ; owl:annotatedTarget "ChEBI" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0475 ; owl:annotatedTarget """DDBJ EMBL GenBank Nucleotide Sequence Database Collaboration exchange new and updated data on a daily basis to achieve optimal synchronisation. http://www.ebi.ac.uk/embl/Contact/collaboration""" . [] a owl:Axiom ; rdfs:label "[A-Z][0-9]{5}|[A-Z][0-9]{5}\\.[0-9]+|[A-Z]{2}[0-9]{6}|[A-Z]{2}[0-9]{6}\\.[0-9]+|[A-Z]{4}[0-9]{8}|[A-Z]{4}[0-9]{8}\\.[0-9]+" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_0475 ; owl:annotatedTarget "id-validation-regexp:" . [] a owl:Axiom ; rdfs:label "http://www.ebi.ac.uk/cgi-bin/dbfetch?db=EMBLSVA&id=${ac}" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_0475 ; owl:annotatedTarget "search-url:" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0475 ; owl:annotatedTarget "DDBJ" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0054 ; owl:annotatedTarget "Flow cytometry" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0475 ; owl:annotatedTarget "DDBJ/EMBL/GenBank" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0475 ; owl:annotatedTarget "EMBL" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0475 ; owl:annotatedTarget "GenBank" . [] oboInOwl:hasDbXref "PMID:15078858" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0476 ; owl:annotatedTarget """Ensembl is a joint project between the EMBL-EBI and the Wellcome Trust Sanger Institute that aims at developing a system that maintains automatic annotation of large eukaryotic genomes. http://www.ensembl.org""" . [] a owl:Axiom ; rdfs:label "ENS[A-Z]+[0-9]{11}|[A-Z]{3}[0-9]{3}[A-Za-z](-[A-Za-z])?|CG[0-9]+|[A-Z0-9]+\\.[0-9]+|YM[A-Z][0-9]{3}[a-z][0-9]" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_0476 ; owl:annotatedTarget "id-validation-regexp:" . [] a owl:Axiom ; rdfs:label "http://www.ensembl.org/Multi/Search/Results?q=${ac}" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_0476 ; owl:annotatedTarget "search-url:" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0476 ; owl:annotatedTarget "Ensembl" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0477 ; owl:annotatedTarget """LocusLink provides a single query interface to curated sequence and descriptive information about genetic loci. http://www.ncbi.nlm.nih.gov/LocusLink/""" . [] a owl:Axiom ; rdfs:label "[0-9]+|[A-Z]{1,2}_[0-9]+|[A-Z]{1,2}_[A-Z]{1,4}[0-9]+" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_0477 ; owl:annotatedTarget "id-validation-regexp:" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0477 ; owl:annotatedTarget "Entrez gene/locuslink" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0054 ; owl:annotatedTarget "facs" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0477 ; owl:annotatedTarget "entrezgene/locuslink" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0478 ; owl:annotatedTarget """FlyBase is a comprehensive database for information on the genetics and molecular biology of Drosophila. http://flybase.org""" . [] a owl:Axiom ; rdfs:label "FB[a-z]{2}[0-9]{7}" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_0478 ; owl:annotatedTarget "id-validation-regexp:" . [] a owl:Axiom ; rdfs:label "http://flybase.org/reports/${ac}" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_0478 ; owl:annotatedTarget "search-url:" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0478 ; owl:annotatedTarget "FlyBase" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0479 ; owl:annotatedTarget """Mouse Genome Informatics (MGI) provides integrated access to data on the genetics, genomics, and biology of the laboratory mouse. http://www.informatics.jax.org/""" . [] a owl:Axiom ; rdfs:label "MGI:[0-9]+" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_0479 ; owl:annotatedTarget "id-validation-regexp:" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0479 ; owl:annotatedTarget "MGD/MGI" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0480 ; owl:annotatedTarget """Online Mendelian Inheritance in Man (OMIM) is a catalogue of human genes and genetic disorders, with links to literature references, sequence records, maps, and related databases. http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=OMIM""" . [] a owl:Axiom ; rdfs:label "[0-9]+" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_0480 ; owl:annotatedTarget "id-validation-regexp:" . [] oboInOwl:hasDbXref "PMID:11558993" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0055 ; owl:annotatedTarget "FRET is a quantum mechanical process involving the radiationless transfer of energy from a donor fluorophore to an appropriately positioned acceptor fluorophore. The fluorophores are genetically fused to the protein in analysis and cotransfected. Three basic conditions must be fulfilled for FRET to occur between a donor molecule and acceptor molecule. First, the donor emission spectrum must significantly overlap the absorption spectrum of the acceptor. Second, the distance between the donor and acceptor fluorophores must fall within the range 20 to 100 Angstrom. Third, the donor and acceptor fluorophores must be in favourable orientations." . [] a owl:Axiom ; rdfs:label "http://www.omim.org/entry/${ac}" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_0480 ; owl:annotatedTarget "search-url:" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0480 ; owl:annotatedTarget "OMIM" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0481 ; owl:annotatedTarget """The Reference Sequence (RefSeq) collection aims to provide a comprehensive, integrated, non-redundant set of sequences, including genomic DNA, transcript (RNA), and protein products, for a number of organisms. http://www.ncbi.nlm.nih.gov/RefSeq/""" . [] a owl:Axiom ; rdfs:label "[XNZ][A-Z]_[0-9]+|[0-9]+|[XNZ][A-Z]_[0-9]+\\.[0-9]+" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_0481 ; owl:annotatedTarget "id-validation-regexp:" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0481 ; owl:annotatedTarget "Refseq" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0482 ; owl:annotatedTarget """Rfam is a large collection of multiple sequence alignments and covariance models covering many common non-coding RNA families. http://www.sanger.ac.uk/Software/Rfam/""" . [] a owl:Axiom ; rdfs:label "RF[0-9]{5}" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_0482 ; owl:annotatedTarget "id-validation-regexp:" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0482 ; owl:annotatedTarget "rfam" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0483 ; owl:annotatedTarget """The Rat Genome Database (RGD) curates and integrates rat genetic and genomic data. http://rgd.mcw.edu/""" . [] a owl:Axiom ; rdfs:label "[0-9]+" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_0483 ; owl:annotatedTarget "id-validation-regexp:" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0055 ; owl:annotatedTarget "FRET" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0483 ; owl:annotatedTarget "RGD" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0484 ; owl:annotatedTarget """SGD is a scientific database of the molecular biology and genetics of the yeast Saccharomyces cerevisiae. http://www.yeastgenome.org/""" . [] a owl:Axiom ; rdfs:label "S[0-9]{9}" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_0484 ; owl:annotatedTarget "id-validation-regexp:" . [] a owl:Axiom ; rdfs:label "http://www.yeastgenome.org/locus/${ac}/overview" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_0484 ; owl:annotatedTarget "search-url:" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0484 ; owl:annotatedTarget "SGD" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0484 ; owl:annotatedTarget "Saccharomyces Genome Database" . [] oboInOwl:hasDbXref "PMID:14681372" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0485 ; owl:annotatedTarget """UniProt Archive (UniParc) is part of UniProt project. It is a non-redundant archive of protein sequences derived from many sources. http://www.ebi.ac.uk/uniparc/""" . [] a owl:Axiom ; rdfs:label "UPI[A-F0-9]{10}" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_0485 ; owl:annotatedTarget "id-validation-regexp:" . [] a owl:Axiom ; rdfs:label "https://www.uniprot.org/uniparc/${ac}/entry" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_0485 ; owl:annotatedTarget "search-url:" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0485 ; owl:annotatedTarget "UniParc" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0055 ; owl:annotatedTarget "FRET analysis" . [] oboInOwl:hasDbXref "PMID:14681372" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0486 ; owl:annotatedTarget """UniProt (Universal Protein Resource) is the world's most comprehensive catalogue of information on proteins. It is a central repository of protein sequence and function created by joining the information contained in Swiss-Prot, TrEMBL, and PIR. http://www.uniprot.org""" . [] a owl:Axiom ; rdfs:label "(([OPQ][0-9][A-Z0-9]{3}[0-9]|[A-NR-Z][0-9]([A-Z][A-Z0-9]{2}[0-9]){1,2})(-[0-9]+)?(-PRO_[0-9]{10})?)" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_0486 ; owl:annotatedTarget "id-validation-regexp:" . [] a owl:Axiom ; rdfs:label "https://www.uniprot.org/uniprotkb/${ac}/entry" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_0486 ; owl:annotatedTarget "search-url:" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0486 ; owl:annotatedTarget "UniProtKB" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0486 ; owl:annotatedTarget "uniprotkb" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0487 ; owl:annotatedTarget """WormBase is the central worm database that houses the gene reports, locus reports, translation reports, expression pattern data and genome browser. http://www.wormbase.org/""" . [] a owl:Axiom ; rdfs:label "WBGene[0-9]{8}" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_0487 ; owl:annotatedTarget "id-validation-regexp:" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0487 ; owl:annotatedTarget "WormBase" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0488 ; owl:annotatedTarget "PSI-MI." . [] a owl:Axiom ; rdfs:label "MI:[0-9]{4}" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_0488 ; owl:annotatedTarget "id-validation-regexp:" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0055 ; owl:annotatedTarget "RET" . [] a owl:Axiom ; rdfs:label "http://www.ebi.ac.uk/ols/ontologies/mi/terms?obo_id=${ac}" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_0488 ; owl:annotatedTarget "search-url:" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0488 ; owl:annotatedTarget "PSI-MI" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0489 ; owl:annotatedTarget "Database that originally provided the interaction record for exchange purposes." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0490 ; owl:annotatedTarget """Describes the location of the experiment. OBSOLETE as a full host organisms description is recommended using tax id == -1 as convention to refer to 'in vitro' interaction.""" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0491 ; owl:annotatedTarget """Results generated by predictive bioinformatics approaches rather than experimental data. OBSOLETE as a full host organisms description is recommended using tax id == -1 as convention to refer to 'in vitro' interaction.""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0491 ; owl:annotatedTarget "Predictive" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0492 ; owl:annotatedTarget """Experiments performed with participants removed from the cellular environment e.g. cell extracts, isolated proteins. OBSOLETE as a full host organisms description is recommended using tax id == -1 as convention to refer to 'in vitro' interaction.""" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0493 ; owl:annotatedTarget """Experiment undertaken within a cellular environment, although this may not be the natural host of the proteins in the study. OBSOLETE as a full host organisms description is recommended using tax id == -1 as convention to refer to 'in vitro' interaction.""" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0494 ; owl:annotatedTarget """Literally, in place i.e. the protein is in its natural environment during the experiment. OBSOLETE as a full host organisms is recommended using tax id == -1 as convention to refer to 'in vitro' interaction.""" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0495 ; owl:annotatedTarget "Role played by the participant within the experiment." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0055 ; owl:annotatedTarget "fret" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0496 ; owl:annotatedTarget "Molecule experimentally treated to capture its interacting partners." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0497 ; owl:annotatedTarget "Molecule role in an experimental setting that does not have an embedded asymmetry." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0498 ; owl:annotatedTarget "Molecule experimentally identified as being captured by a given bait." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0499 ; owl:annotatedTarget "Role not specified or not applicable to the data." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0500 ; owl:annotatedTarget "Physiological role of an interactor in a cell or in vivo environment, which is reproduced in the current experiment." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0501 ; owl:annotatedTarget "Molecule catalyzing a modification on its interacting partner." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0502 ; owl:annotatedTarget "Molecule that is the target of its binding partner catalytic activity." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0502 ; owl:annotatedTarget "substrate" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0503 ; owl:annotatedTarget "Molecule that makes intramolecular interactions." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0505 ; owl:annotatedTarget "The form of a molecule that was actually used to experimentally demonstrate the interaction, that may differ from the sequence described by the identifying accession number." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0056 ; owl:annotatedTarget "Sequencing occurs during the course of the experiment. DNA sequencing is the process of determining the nucleotide order of a given DNA fragment. Thus far, most DNA sequencing has been performed using the chain termination method developed by Frederick Sanger. This technique uses sequence-specific termination of a DNA synthesis reaction using modified nucleotide substrates. However, new sequencing technologies such as Pyrosequencing are generating the majority of data." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0506 ; owl:annotatedTarget "A molecule is estimated to be expressed at higher levels than in physiological condition." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0506 ; owl:annotatedTarget "over-expressed" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0507 ; owl:annotatedTarget "Small molecules, peptides or full proteins that can be used as label as they confer some property that facilitates identification purification and monitoring to the labeled molecule." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0508 ; owl:annotatedTarget "Measures the release of radiolabelled acetic acid from a pre-labeled molecule." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0508 ; owl:annotatedTarget "radiolabeled acetate" . [] oboInOwl:hasDbXref "PMID:14987100" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0509 ; owl:annotatedTarget "Measures quenching of the nonradiative energy transfer between fluorescent long-lifetime lanthanide chelates and different acceptors. Relies on a fluorescence energy donor and acceptor being removed from close proximity on the phosphorylated substrate due to the action of the phosphatase." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0509 ; owl:annotatedTarget "homogeneous time-resolved fluorescence" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0509 ; owl:annotatedTarget "phosphatase HTRF" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0509 ; owl:annotatedTarget "phosphatase htrf" . [] oboInOwl:hasDbXref "PMID:14987100" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0510 ; owl:annotatedTarget "Methods based on the exceptionally long fluorescence lifetime characteristics of certain fluorophores, which allows the elimination of the effects of background fluorescence. Uses nonradiative energy transfer or quenching between fluorescent lanthanide chelates and different acceptors to measure reaction rates." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0005 ; owl:annotatedTarget "This approach is used to identify the residues that are involved in an interaction. Several variants of the native protein are prepared by sequentially mutating each residue of interest to an alanine. The mutated proteins are expressed and probed in the binding assay." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0056 ; owl:annotatedTarget "full dna sequence" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0510 ; owl:annotatedTarget "homogeneous time-resolved fluorescence" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0510 ; owl:annotatedTarget "htrf" . [] oboInOwl:hasDbXref "PMID:14987100" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0511 ; owl:annotatedTarget "Measures quenching of the nonradiative energy transfer between fluorescent long-lifetime lanthanide chelates and different acceptors. Fluorescence donor and acceptor are on the same peptide molecule and separated by the action of the protease." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0511 ; owl:annotatedTarget "Protease HTRF" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0511 ; owl:annotatedTarget "protease htrf" . [] oboInOwl:hasDbXref "PMID:2071592" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0512 ; owl:annotatedTarget "Samples run on a gelatine containing gels under non-reducing condition, gels then incubated under conditions in which the enzyme is active. Gels are stained with coomasie and gelatine-free regions of the gel taken as a measure of enzyme activity." . [] oboInOwl:hasDbXref "PMID:6247938" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0513 ; owl:annotatedTarget "Measures the amount of radiolabel released into the medium when enzyme is added onto a film of isotope-labelled collagen." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0514 ; owl:annotatedTarget "Substrate pre-radiolabelled either synthetically or through the action of a kinase transferring an isotope of phosphate from a nucleotide. Substrate then exposed to phosphate under assay conditions. Substrate isolated by gel electrophoresis and loss of radiolabelling confirmed by autoradiography." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0514 ; owl:annotatedTarget "in gel phosphatase" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0515 ; owl:annotatedTarget "Measures the catalysis of the transfer of a methyl group to an acceptor molecule." . [] oboInOwl:hasDbXref "PMID:9787636" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0057 ; owl:annotatedTarget "Gene pairs that show a conserved topological neighbourhood in many prokaryotic genomes are considered by this approach to encode interacting or functionally related proteins. By measuring the physical distance of any given gene pair in different genomes, interacting partners are inferred." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0515 ; owl:annotatedTarget "methyltransferase as" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0516 ; owl:annotatedTarget "Measures the transfer of a radiolabelled methyl group of a donor, for example S-adenosyl-L-methionine (SAM) to a carboxyl group of an acceptor." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0516 ; owl:annotatedTarget "radiolabeled methyl" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0517 ; owl:annotatedTarget "A radiolabelled molecule has radio isotopes among its constituent atoms that can be used to identify, localize or quantify the full molecule." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0517 ; owl:annotatedTarget "radiolabeled" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0517 ; owl:annotatedTarget "radiolabelled" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0518 ; owl:annotatedTarget "The protein of interest is expressed as a fusion to the peptide DYKDDDDKV for which antibodies are commercially available. Sometimes multiple copies of the peptide are fused in tandem." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0518 ; owl:annotatedTarget "DYKDDDDKV epitope tag" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0518 ; owl:annotatedTarget "FLAG" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0518 ; owl:annotatedTarget "FLAG-tagged" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0058 ; owl:annotatedTarget "Methods that require fully sequenced genomes either because they are based on the comparison of genome topology or on the identification of orthologous sequences in different genomes." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0519 ; owl:annotatedTarget "The protein is expressed and purified as a fusion to the glutathione S-tranferase protein." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0519 ; owl:annotatedTarget "glutathione S-tranferase tag" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0519 ; owl:annotatedTarget "gst tag" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0520 ; owl:annotatedTarget "The protein of interest is expressed as a fusion to the peptide YPYDVPDYA (a fragment of the influenza hemagglutinin protein) for which antibodies are commercially available." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0520 ; owl:annotatedTarget "YPYDVPDYA epitope tag" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0521 ; owl:annotatedTarget "The protein of interest is expressed as a fusion to a poly-His tail. This permits purification by chromatography over a metal column or by binding to commercially available anti poly-His antibodies." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0521 ; owl:annotatedTarget "6-His-tag" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0521 ; owl:annotatedTarget "Hexa-His-tag" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0521 ; owl:annotatedTarget "Histidine-tag" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0522 ; owl:annotatedTarget "The protein of interest is expressed as a fusion to the peptide EUKLISEED (a fragment of the Myc oncogene protein) for which antibodies are commercially available. Sometimes multiple copies of the peptide are fused in tandem." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0058 ; owl:annotatedTarget "genome prediction" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0522 ; owl:annotatedTarget "EUKLISEED epitope tag" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0523 ; owl:annotatedTarget "The protein of interest is expressed as a fusion to the peptide MASMTGGQQMG for which antibodies are commercially available." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0523 ; owl:annotatedTarget "MASMTGGQQMG epitope tag" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0524 ; owl:annotatedTarget "Tag encoding a calmodulin binding peptide, a TEV cleavage site, and the Staphylococcus aureus Protein A fused to a target protein. The tag allows two purification steps ensuring a highly selective purification of the tagged protein." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0524 ; owl:annotatedTarget "CBP-ProtA tagged" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0524 ; owl:annotatedTarget "tap tagged" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0525 ; owl:annotatedTarget "The protein of interest is expressed as a fusion to the peptide GKPIPNPLLGLDST for which antibodies are commercially available." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0525 ; owl:annotatedTarget "GKPIPNPLLGLDST epitope tag" . [] oboInOwl:hasDbXref "PMID:14755292", "RESID:AA0048", "RESID:AA0055" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0526 ; owl:annotatedTarget """Residue modification. OBSOLETE remap to MOD:00723.""" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0526 ; owl:annotatedTarget "acetyllysine" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0059 ; owl:annotatedTarget """The bait protein is expressed and purified as a fusion to the glutathione S-tranferase protein. The bait protein is normally attached to a glutathione sepharose resin or alternatively to a support containing an anti-GST antibody. OBSOLETE redundant term. Map to feature type : gst-tagged (MI:0519) and Interaction detection method: pull down (MI:0096).""" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0527 ; owl:annotatedTarget """Residue modification. OBSOLETE remap to MOD:00752.""" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0527 ; owl:annotatedTarget "adp-ribosylated" . [] oboInOwl:hasDbXref "PMID:14755292", "RESID:AA0168" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0528 ; owl:annotatedTarget """Residue modification. OBSOLETE remap to MOD:00177.""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0528 ; owl:annotatedTarget "(S)-2-amino-5-([imino([adenosine 5'-(trihydrogen diphosphate) 5'->5'-ester with alpha-D-ribofuranosyl]amino)methyl]amino)pentanoic acid" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0528 ; owl:annotatedTarget "N(omega)-[alpha-D-ribofuranoside 5'->5'-ester with adenosine 5'-(trihydrogen diphosphate)]-L-arginine" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0528 ; owl:annotatedTarget "N(omega)-alpha-D-ribofuranosyl-L-arginine 5'->5'-ester with adenosine 5'-(trihydrogen diphosphate)" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0528 ; owl:annotatedTarget "adp-ribosylarginine" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0528 ; owl:annotatedTarget "omega-N-(ADP-ribosyl)-L-arginine" . [] oboInOwl:hasDbXref "PMID:14755292", "RESID:AA0169" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0529 ; owl:annotatedTarget """Residue modification. OBSOLETE remap to MOD:00178.""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0529 ; owl:annotatedTarget "(R)-2-amino-3-([adenosine 5'-(trihydrogen diphosphate) 5'->5'-ester with alpha-D-ribofuranosyl]sulfanyl)propanoic acid" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0060 ; owl:annotatedTarget """The protein of interest is expressed as a fusion to the peptide YPYDVPDYA (a fragment of the influenza hemaglutinin protein) for which antibodies are commercially available. OBSOLETE redundant term. Map to feature type : ha-tagged (MI:0520) and Interaction detection method: anti tag coimmunoprecipitation (MI:0007).""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0529 ; owl:annotatedTarget "S-(ADP-ribosyl)-L-cysteine" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0529 ; owl:annotatedTarget "S-L-cysteine alpha-D-ribofuranoside 5'->5'-ester with adenosine 5'-(trihydrogen diphosphate)" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0529 ; owl:annotatedTarget "S-alpha-D-ribofuranosyl-L-cysteine 5'->5'-ester with adenosine 5'-(trihydrogen diphosphate)" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0529 ; owl:annotatedTarget "adp-ribosylcysteine" . [] oboInOwl:hasDbXref "PMID:14755292", "RESID:AA0295" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0530 ; owl:annotatedTarget """Residue modification. OBSOLETE remap to MOD:00300.""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0530 ; owl:annotatedTarget "(S)-2-amino-5-poly[2'-adenosine 5'-(trihydrogen diphosphate) 5'->5'-ester with 1alpha-D-ribofuranosyl]oxy-5-oxopentanoic acid" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0530 ; owl:annotatedTarget "L-glutamyl-5-poly(ADP-ribose)" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0530 ; owl:annotatedTarget "L-isoglutamyl-poly(ADP-ribose)" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0530 ; owl:annotatedTarget "adp-ribosylglutamate" . [] oboInOwl:hasDbXref "PMID:14755292", "RESID:AA0237" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0531 ; owl:annotatedTarget """Residue modification. OBSOLETE remap to MOD:00242.""" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0060 ; owl:annotatedTarget "ha tag coip" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0531 ; owl:annotatedTarget "(S)-2-amino-3-([adenosine 5'-(trihydrogen diphosphate) 5'->5'-ester with alpha-D-ribofuranosyl]oxy)-propanoic acid Formula" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0531 ; owl:annotatedTarget "O-(ADP-ribosyl)-L-serine" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0531 ; owl:annotatedTarget "O3-(ADP-ribosyl)-L-serine" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0531 ; owl:annotatedTarget "O3-[alpha-D-ribofuranoside 5'->5'-ester with adenosine 5'-(trihydrogen diphosphate)]-L-serine" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0531 ; owl:annotatedTarget "O3-alpha-D-ribofuranosyl-L-serine 5'->5'-ester with adenosine 5'-(trihydrogen diphosphate)" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0531 ; owl:annotatedTarget "adp-ribosylserine" . [] oboInOwl:hasDbXref "PMID:14755292", "RESID:AA0231" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0532 ; owl:annotatedTarget """Residue modification. OBSOLETE remap to MOD:00236.""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0532 ; owl:annotatedTarget "(S)-2-amino-4-([adenosine 5'-(trihydrogen diphosphate) 5'->5'-ester with alpha-D-ribofuranosyl]amino)-4-oxobutanoic acid" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0532 ; owl:annotatedTarget "N4-(ADP-ribosyl)-L-asparagine" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0532 ; owl:annotatedTarget "N4-[alpha-D-ribofuranoside 5'->5'-ester with adenosine 5'-(trihydrogen diphosphate)]-L-asparagine" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0061 ; owl:annotatedTarget """The bait protein is expressed and purified fused to an amino or carboxyterminal tail containing a variable number of histidines. The bait protein is normally attached to a metal (usually nickel) resin. OBSOLETE redundant term. Map to feature type : his-tagged (MI:0521) and Interaction detection method: pull down (MI:0096).""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0532 ; owl:annotatedTarget "N4-alpha-D-ribofuranosyl-L-asparagine 5'->5'-ester with adenosine 5'-(trihydrogen diphosphate)" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0532 ; owl:annotatedTarget "adpribosylasparagine" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0533 ; owl:annotatedTarget """Residue modification. OBSOLETE remap to MOD:00693.""" . [] oboInOwl:hasDbXref "PMID:14755292", "RESID:AA0122" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0534 ; owl:annotatedTarget """Residue modification. OBSOLETE remap to MOD:00131.""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0534 ; owl:annotatedTarget "S-glycosyl-L-cysteine" . [] oboInOwl:hasDbXref "PMID:14755292", "RESID:AA0154" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0535 ; owl:annotatedTarget """Residue modification. OBSOLETE remap to MOD:00163.""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0535 ; owl:annotatedTarget "O-glycosyl-L-serine" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0535 ; owl:annotatedTarget "O3-glycosyl-L-serine" . [] oboInOwl:hasDbXref "PMID:14755292", "RESID:AA0155" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0536 ; owl:annotatedTarget """Residue modification. OBSOLETE remap to MOD:00164.""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0536 ; owl:annotatedTarget "O-glycosyl-L-threonine" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0062 ; owl:annotatedTarget """The protein of interest is expressed as a fusion to a poly-His tail. This permits purification by chromatography over a metal column or by binding to commercially available anti poly-His antibodies. OBSOLETE redundant term. Map to feature type: his-tagged (MI:0521) and Interaction detection method: anti tag coimmunoprecipitation (MI:0007).""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0536 ; owl:annotatedTarget "O3-glycosyl-L-threonine" . [] oboInOwl:hasDbXref "PMID:14755292", "RESID:AA0327" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0537 ; owl:annotatedTarget """Residue modification. OBSOLETE remap to MOD:00332.""" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0537 ; owl:annotatedTarget "glycosylarginine" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0537 ; owl:annotatedTarget "omega-N-glycosyl-L-arginine" . [] oboInOwl:hasDbXref "PMID:14755292", "RESID:AA0151" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0538 ; owl:annotatedTarget """Residue modification. OBSOLETE remap to MOD:00160.""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0538 ; owl:annotatedTarget "N4-glycosyl-L-asparagine" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0538 ; owl:annotatedTarget "glycosylasparagine" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0539 ; owl:annotatedTarget """Residue modification. OBSOLETE remap to MOD:00818.""" . [] oboInOwl:hasDbXref "PMID:14755292", "RESID:AA0163" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0540 ; owl:annotatedTarget """Residue modification. OBSOLETE remap to MOD:00172.""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0540 ; owl:annotatedTarget "N-alanyl-glycosylphosphatidylinositolethanolamine" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0062 ; owl:annotatedTarget "his tag coip" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0540 ; owl:annotatedTarget "gpi-alanine" . [] oboInOwl:hasDbXref "PMID:14755292", "RESID:AA0158" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0541 ; owl:annotatedTarget """Residue modification. OBSOLETE remap to MOD:00167.""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0541 ; owl:annotatedTarget "N-asparaginyl-glycosylphosphatidylinositolethanolamine" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0541 ; owl:annotatedTarget "gpi-asparagine" . [] oboInOwl:hasDbXref "PMID:14755292", "RESID:AA0159" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0542 ; owl:annotatedTarget """Residue modification. OBSOLETE remap to MOD:00168.""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0542 ; owl:annotatedTarget "N-aspartyl-glycosylphosphatidylinositolethanolamine" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0542 ; owl:annotatedTarget "gpi-aspartate" . [] oboInOwl:hasDbXref "PMID:14755292", "RESID:AA0160" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0543 ; owl:annotatedTarget """Residue modification. OBSOLETE remap to MOD:00169.""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0543 ; owl:annotatedTarget "N-cysteinyl-glycosylphosphatidylinositolethanolamine" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0543 ; owl:annotatedTarget "gpi-cysteine" . [] oboInOwl:hasDbXref "PMID:7708014" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0006 ; owl:annotatedTarget "A specific antibody for the molecule of interest (bait) is available, this is used to generate a high affinity resin to capture the endogenous bait present in a sample." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0063 ; owl:annotatedTarget "Computational methods to predict an interaction." . [] oboInOwl:hasDbXref "PMID:14755292", "RESID:AA0161" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0544 ; owl:annotatedTarget """Residue modification. OBSOLETE remap to MOD:00170.""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0544 ; owl:annotatedTarget "N-glycyl-glycosylphosphatidylinositolethanolamine" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0544 ; owl:annotatedTarget "gpi-glycine" . [] oboInOwl:hasDbXref "PMID:14755292", "RESID:AA0162" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0545 ; owl:annotatedTarget """Residue modification. OBSOLETE remap to MOD:00171.""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0545 ; owl:annotatedTarget "N-seryl-glycosylphosphatidylinositolethanolamine" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0545 ; owl:annotatedTarget "gpi-serine" . [] oboInOwl:hasDbXref "PMID:14755292", "RESID:AA0164" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0546 ; owl:annotatedTarget """Residue modification. OBSOLETE remap to MOD:00173.""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0546 ; owl:annotatedTarget "N-threonyl-glycosylphosphatidylinositolethanolamine" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0546 ; owl:annotatedTarget "gpi-threonine" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0547 ; owl:annotatedTarget """Residue modification. OBSOLETE remap to MOD:01110.""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0063 ; owl:annotatedTarget "in silico methods" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0547 ; owl:annotatedTarget "prenylcysteine" . [] oboInOwl:hasDbXref "PMID:14755292", "RESID:AA0074", "RESID:AA0075", "RESID:AA0076" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0548 ; owl:annotatedTarget """Residue modification. OBSOLETE remap to MOD:00663.""" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0548 ; owl:annotatedTarget "methylatedlysine" . [] oboInOwl:hasDbXref "PMID:15325307" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0549 ; owl:annotatedTarget """Artificial residue modification enabling studies of cysteine binding status. OBSOLETE remap to MOD:00660.""" . [] oboInOwl:hasDbXref "PMID:14755292", "RESID:AA0032" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0550 ; owl:annotatedTarget """Residue modification. OBSOLETE remap to MOD:00041.""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0550 ; owl:annotatedTarget "(S)-3-amino-1,1,3-propanetricarboxylic acid" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0550 ; owl:annotatedTarget "1-carboxyglutamic acid [misnomer]" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0550 ; owl:annotatedTarget "4-carboxyglutamic acid" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0550 ; owl:annotatedTarget "L-gamma-carboxyglutamic acid" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0550 ; owl:annotatedTarget "carboxyglutamic acid" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0063 ; owl:annotatedTarget "predicted interac" . [] oboInOwl:hasDbXref "PMID:15657065", "PMID:9636206" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0551 ; owl:annotatedTarget """Residue modification. OBSOLETE remap to MOD:00461.""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0551 ; owl:annotatedTarget "nitrated tyrosine" . [] oboInOwl:hasDbXref "PMID:14755292", "RESID:AA0230" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0552 ; owl:annotatedTarget """Residue modification. OBSOLETE remap to MOD:00235.""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0552 ; owl:annotatedTarget "(R)-2-amino-3-nitrososulfanyl-propanoic acid" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0552 ; owl:annotatedTarget "L-cysteine nitrite ester" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0552 ; owl:annotatedTarget "S-nitrosocysteine" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0552 ; owl:annotatedTarget "S-nitrosyl-L-cysteine" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0552 ; owl:annotatedTarget "nitrosylcysteine" . [] oboInOwl:hasDbXref "PMID:14755292", "RESID:AA0172" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0553 ; owl:annotatedTarget """Residue modification. OBSOLETE remap to MOD:00181.""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0553 ; owl:annotatedTarget "(S)-2-amino-3-(4-sulfooxyphenyl)propanoic acid" . [] oboInOwl:hasDbXref "PMID:11731503" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0064 ; owl:annotatedTarget "Protein interactions, experimentally detected in an organism, are extended to a second organism assuming that homologue proteins, in different organisms, maintain their interaction properties." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0553 ; owl:annotatedTarget "2-amino-3-(4-hydroxyphenyl)propanoic acid 4'-sulfate" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0553 ; owl:annotatedTarget "O4'-sulfo-L-tyrosine" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0553 ; owl:annotatedTarget "O4-sulfotyrosine" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0553 ; owl:annotatedTarget "sulfotyrosine" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0553 ; owl:annotatedTarget "tyrosine sulfate" . [] oboInOwl:hasDbXref "PMID:12612601", "RESID:AA0125" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0554 ; owl:annotatedTarget """Residue modification due to a cross-link between a lysine and a glycine from the sumo (Small Ubiquitin-related MOdifier) protein. OBSOLETE remap to MOD:01149.""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0554 ; owl:annotatedTarget "(S)-2-amino-6-[(aminoacetyl)amino]hexanoic acid" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0554 ; owl:annotatedTarget "N6-glycyl-L-lysine" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0554 ; owl:annotatedTarget "N6-glycyllysine" . [] oboInOwl:hasDbXref "PMID:14755292", "RESID:AA0035", "RESID:AA0036" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0555 ; owl:annotatedTarget """Residue modification. OBSOLETE remap to MOD:00890.""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0064 ; owl:annotatedTarget "Homology based interaction prediction" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0555 ; owl:annotatedTarget "phosphoshistidine" . [] oboInOwl:hasDbXref "PMID:14755292", "RESID:AA0124" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0556 ; owl:annotatedTarget "Gln-Lys cross-link catalyzed by a transglutaminase." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0556 ; owl:annotatedTarget "transglutamination" . [] oboInOwl:hasDbXref "GO:0006471", "PMID:14755292", "RESID:AA0168", "RESID:AA0169", "RESID:AA0231", "RESID:AA0237", "RESID:AA0295" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0557 ; owl:annotatedTarget "Involves the addition of one or more ADP-ribose moieties to proteins. Reaction that can affect Arg, Cys, Glu, Arg and Asn residues." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0557 ; owl:annotatedTarget "adp ribosylation" . [] oboInOwl:hasDbXref "GO:0006517", "PMID:15670854" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0558 ; owl:annotatedTarget "Reaction catalyzed by PNGase, a deglycosylating enzyme that promotes the hydrolysis of the beta-aspartylglycosylamine bond of aspargine-linked glycopeptides and glycoproteins." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0558 ; owl:annotatedTarget "deglycosylation" . [] oboInOwl:hasDbXref "GO:0043413", "PMID:14755292", "RESID:AA0122", "RESID:AA0151", "RESID:AA0154", "RESID:AA0155", "RESID:AA0327" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0559 ; owl:annotatedTarget "The covalent attachment of a glycosyl residue to one or more monomeric units in a polypeptide, polynucleotide, polysaccharide, or other biological polymer. Reaction that can affect Ser, Thr, Cys, Arg, and Asn residues. This reaction is known to be reversible in the case of Asn substrate." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0559 ; owl:annotatedTarget "glycosylation" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0560 ; owl:annotatedTarget """Residue modification. OBSOLETE remap to MOD:00438.""" . [] oboInOwl:hasDbXref "PMID:11785756" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0065 ; owl:annotatedTarget "Isothermal titration calorimetry (ITC) measures directly the energy associated with a chemical reaction triggered by the mixing of two components. A typical ITC experiment is carried out by the stepwise addition of one of the reactants (~10-6 L per injection) into the reaction cell (~1mL) containing the second reactant. The chemical reaction occurring after each injection either releases or absorbs heat (qi) proportional to the amount of ligand that binds to the protein with a characteristic binding enthalpy (DH). As modern ITC instruments operate on the heat compensation principle, the instrumental response (measured signal) is the amount of power (microcalories per second) necessary to maintain constant the temperature difference between the reaction and the reference cells. Because the amount of uncomplexed protein available progressively decreases after each successive injection, the magnitude of the peaks becomes progressively smaller until complete saturation is achieved. The difference between the concentration of bound ligand in the ith and (i-1)th injections depends on the binding constant Ka and the total ligand injected. The calculations depend on the binding model (number of substrates). Analysis of the data yields DH and DG = -RTlnKa. The entropy change is obtained by using the standard thermodynamic expression DG = DH-TDS." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0560 ; owl:annotatedTarget "myristoylated aa" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0561 ; owl:annotatedTarget """Residue modification. OBSOLETE remap to MOD:00440.""" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0561 ; owl:annotatedTarget "palmitoylated aa" . [] oboInOwl:hasDbXref "PMID:14755292", "RESID:AA0061", "RESID:AA0062" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0562 ; owl:annotatedTarget """Residue modification. OBSOLETE remap to MOD:00665.""" . [] oboInOwl:hasDbXref "PMID:14755292", "RESID:AA0068", "RESID:AA0069" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0563 ; owl:annotatedTarget """Residue modification. OBSOLETE remap to MOD:00658.""" . [] oboInOwl:hasDbXref "PMID:14755292", "RESID:AA0069" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0564 ; owl:annotatedTarget """Residue modification. OBSOLETE remap to MOD:00078.""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0564 ; owl:annotatedTarget "(S)-2-amino-5-[(imino(methylamino)methyl)amino]pentanoic acid" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0564 ; owl:annotatedTarget "NG-methylarginine;" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0564 ; owl:annotatedTarget "methylarginine" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0564 ; owl:annotatedTarget "omega-N-methyl-L-arginine" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0065 ; owl:annotatedTarget "ITC" . [] oboInOwl:hasDbXref "PMID:111" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0565 ; owl:annotatedTarget """Residue modification due to a cross-link between a lysine and a glycine from the Nedd8 protein family. OBSOLETE remap to MOD:01150.""" . [] oboInOwl:hasDbXref "GO:0016925", "PMID:15985640" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0566 ; owl:annotatedTarget "Reversible reaction that create a covalent bond between a C-terminus G of an ubiquitine like sumo protein and a K residue of the target." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0566 ; owl:annotatedTarget "sumoylation" . [] oboInOwl:hasDbXref "GO:0045116", "PMID:16127432" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0567 ; owl:annotatedTarget "Reversible reaction that create a covalent bond between a Glycine residue of an ubiquitine like NEDD8 protein and a lysine residue of the target." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0567 ; owl:annotatedTarget "neddylation" . [] oboInOwl:hasDbXref "GO:0016926", "PMID:15985640" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0568 ; owl:annotatedTarget "Cleavage of the G-K bond and release of the SUMO ubiquitin like proteins." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0568 ; owl:annotatedTarget "desumoylation" . [] oboInOwl:hasDbXref "GO:0000338", "PMID:16127432" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0569 ; owl:annotatedTarget "Cleavage of the G-K bond and release of the NEDD8 ubiquitin like proteins. Deneddylation, which removes the NEDD8 moiety, requires the isopeptidase activity of the COP9 signalosome." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0569 ; owl:annotatedTarget "deneddylation" . [] oboInOwl:hasDbXref "PMID:14744292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0570 ; owl:annotatedTarget "Covalent modification of a polypeptide occuring during its maturation or its proteolytic degradation." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0065 ; owl:annotatedTarget "itc" . [] oboInOwl:hasDbXref "GO:0006379", "PMID:14681407" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0571 ; owl:annotatedTarget "Any process by which a pre-mRNA or mRNA molecule is cleaved at specific sites or in a regulated manner." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0572 ; owl:annotatedTarget "Covalent bond breakage of a DNA molecule leading to the formation of smaller fragments." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0573 ; owl:annotatedTarget "Region of a molecule whose mutation or deletion totally disrupts an interaction strength or rate (in the case of interactions inferred from enzymatic reaction).." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0573 ; owl:annotatedTarget "mutation disrupting" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0574 ; owl:annotatedTarget "Identifier of a publication prior to pubmed indexing." . [] a owl:Axiom ; rdfs:label "\\d+.\\d+/[a-zA-Z0-9\\.\\:]+" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_0574 ; owl:annotatedTarget "id-validation-regexp:" . [] a owl:Axiom ; rdfs:label "http://dx.doi.org/${ac}" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_0574 ; owl:annotatedTarget "search-url:" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0574 ; owl:annotatedTarget "doi" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0575 ; owl:annotatedTarget """Alliance for Cellular Signaling (AfCS -Nature) store yeast 2-hybrid Interaction data and expression data. Information and data are freely available to all. http://www.signaling-gateway.org""" . [] a owl:Axiom ; rdfs:label "[0-9]+" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_0575 ; owl:annotatedTarget "id-validation-regexp:" . [] oboInOwl:hasDbXref "PMID:7682645" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0066 ; owl:annotatedTarget "Morphologically classified as one of the siphoviridae, lambda is a temperate bacteriophage of E.coli, with a double-stranded DNA genome. It has an icosahedral head attached to a flexible helical tail. Both the tail protein pV and the head protein pD have been used for displaying (C or N terminally) foreign peptides on the viral capsid." . [] a owl:Axiom ; rdfs:label "http://www.signaling-gateway.org/data/Y2H/cgi-bin/y2h_int.cgi?id=${ac}" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_0575 ; owl:annotatedTarget "search-url:" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0575 ; owl:annotatedTarget "AfCS" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0575 ; owl:annotatedTarget "afcs" . [] oboInOwl:hasDbXref "PMID:15353450" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0576 ; owl:annotatedTarget "Method to identify domain-domain interactions within the same resolved structure. Domains are first projected onto a pdb structure and then the distance between all pairs of residues in different domains are calculated. When the distance between 2 residues is below the non covalent bond threshold, the corresponding pair of domains is predicted to interact." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0577 ; owl:annotatedTarget "Group of method taking advantage of 3D structure to calculate and infer the feature of interacting molecules." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0577 ; owl:annotatedTarget "feature struct pred" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0578 ; owl:annotatedTarget "The protein is expressed and purified as a fusion to the glutathione maltose-binding protein (MBP). The MBP-fusion protein can be purified by affinity chromatography using an amylose resin." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0578 ; owl:annotatedTarget "maltose binding protein tag" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0578 ; owl:annotatedTarget "mbp tag" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0579 ; owl:annotatedTarget "Any molecule that is able to transfer an electron to another chemical species." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0066 ; owl:annotatedTarget "lambda phage" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0580 ; owl:annotatedTarget "Molecule to which an electron may be transferred from an electron donor." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0581 ; owl:annotatedTarget "A gene whose genetic perturbation suppresses the phenotype resulting from a different genetic perturbation." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0581 ; owl:annotatedTarget "suppressor" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0582 ; owl:annotatedTarget "A gene whose genetic perturbation phenotype is suppressed by a different genetic perturbation." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0582 ; owl:annotatedTarget "suppressed" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0583 ; owl:annotatedTarget "Fluorophore which emits electromagnetic radiation of given wavelength." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0584 ; owl:annotatedTarget "Fluorophore able to absorb the electromagnetic radiation at given wavelength from a specific donor fluorophore, then re-emiting its own characteristic fluorescence." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0584 ; owl:annotatedTarget "fluorescence accept" . [] oboInOwl:hasDbXref "PMID:14681451" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0585 ; owl:annotatedTarget """IntEnz is the name for the Integrated relational Enzyme database and is the official version of the Enzyme Nomenclature. The Enzyme Nomenclature comprises recommendations of the Nomenclature Committee of the International Union of Bio chemistry and Molecular Biology (NC-IUBMB) on the nomenclature and classification of enzyme-catalysed reactions. IntEnz is supported by NC-IUBMB and contains enzyme data curated and approved by this committee. The database IntEnz is available at. http://www.ebi.ac.uk/intenz""" . [] a owl:Axiom ; rdfs:label "[0-6]{1}\\.(\\d+|-)\\.(\\d+|-)\\.(\\d+|-)" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_0585 ; owl:annotatedTarget "id-validation-regexp:" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0006 ; owl:annotatedTarget "anti bait coip" . [] oboInOwl:hasDbXref "PMID:9013660" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0067 ; owl:annotatedTarget "Dynamic and static laser light scattering probes the size, shape, and structure of biological macromolecules or of their assemblies. A beam is focused on an optically clear cylindrical cell containing the sample. Most of the light passes directly through the sample. A small portion of the light is scattered; the scattered light intensity containing information about the scattering particle is detected at an angle (typically in the range 15-180degrees) from the direction of the incident beam." . [] a owl:Axiom ; rdfs:label "http://www.ebi.ac.uk/intenz/query?cmd=Search&q=${ac}&t=exact&fields=ec" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_0585 ; owl:annotatedTarget "search-url:" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0586 ; owl:annotatedTarget "Molecule inhibiting an interaction by interacting with one or more of its participants." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0587 ; owl:annotatedTarget """Molecule being identified as target of an inhibitor. OBSOLETE as term is deprecated to describe the target of an inhibitor that can have any other biological role.""" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0588 ; owl:annotatedTarget "Group of methods based on complementation assay where a third participant is shown to be necessary for the binding of a given bait prey pair. The molecule fused to the DNA binding domain is the bait, that fused to the transcriptional activator is the prey." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0588 ; owl:annotatedTarget "3 hybrid" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0588 ; owl:annotatedTarget "3-hybrid" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0588 ; owl:annotatedTarget "tri hybrid" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0588 ; owl:annotatedTarget "tri-hybrid assay" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0589 ; owl:annotatedTarget "Protein sample collected by in vitro translation of its mRNA taking advantage of purified translation machinery." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0589 ; owl:annotatedTarget "in vitro translated" . [] oboInOwl:hasDbXref "PMID:11395414", "PMID:11875433" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0068 ; owl:annotatedTarget "Mass spectrometry can be used to characterise chemical modifications within peptides. One approach consists in the observation of a mass difference when a sample is treated with an enzyme that can specifically remove a peptide modification, for instance a phosphatase. The mass difference corresponds to the mass of the chemical group covalently linked to a residue. Such experiments carried out with a MALDI-TOF (Matrix-assisted laser desorption ionization time-of-flight ) do not allow the mapping of the modification site within the sequence, whereas any tandem mass spectrometer (LC MS/MS Liquid Chromatography Tandem Mass Spectrometry, nanoESI MS/MS nanoElectrospray Ionisation tandem mass spectrometry, FTMS Fourier Transform mass spectrometry) provide such information. A second approach consists of the direct mass measurement of the ionized chemical group dissociated from the residue within a tandem mass spectrometer. Both approaches need a prior enrichment of the modified peptide population in the samples with IMAC (Immobilized Metal Affinity Chromatography)or specific anti-modification antibodies." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0590 ; owl:annotatedTarget "Collection of topics describing the free text stored as an attribute value." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0590 ; owl:annotatedTarget "CvTopic" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0591 ; owl:annotatedTarget "The experimental condition text description, should contain information about the organisms hosting the interaction." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0591 ; owl:annotatedTarget "experiment descripti" . [] oboInOwl:hasDbXref "PMID:15353450" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0592 ; owl:annotatedTarget """Web resource that allows the investigation of protein interactions in the Protein Data Bank structures at the level of Pfam domains and amino acid residues. iPfam is available on the Web for browsing at. http://www.sanger.ac.uk/Software/Pfam/iPfam/""" . [] oboInOwl:hasDbXref "PMID:14681407" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0593 ; owl:annotatedTarget "Xref pointing to a GO process term describing the start and end location of a migrating molecule, for instance see GO:0006611, 'protein-nucleus export'." . [] oboInOwl:hasDbXref "PMID:14681407" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0594 ; owl:annotatedTarget "Xref pointing to a GO compartment term describing the start location of a migrating molecule." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0595 ; owl:annotatedTarget "Xref pointing to a GO compartment term describing the end location of a migrating molecule." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0596 ; owl:annotatedTarget "Free text description of all the tags and artificial process undergone by a molecule during an experiment." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0596 ; owl:annotatedTarget "experimental form de" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0068 ; owl:annotatedTarget "modified residue ms" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0597 ; owl:annotatedTarget "The feature text description may include information about the feature detection method." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0598 ; owl:annotatedTarget "The feature constraint free text will specificity whether a biological feature is shown to be possible (just observed) or required (experimentally demonstrated to be necessary for an interaction)." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0599 ; owl:annotatedTarget "Text pointing to a specific paper figure legend where the experimental evidences for an interaction are to be found." . [] oboInOwl:hasDbXref "PMID:15608217" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0600 ; owl:annotatedTarget """Two silent mutations show a nutrition sensitive lethal phenotype when they co-occur on the same cell. OBSOLETE: remap to CV intraction type 'synthetic interaction' MI:0794 and external CV for phenotype description.""" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0600 ; owl:annotatedTarget "nutrition synt letal" . [] oboInOwl:hasDbXref "PMID:15892872" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0601 ; owl:annotatedTarget "The Sequence Ontology (SO) is a structured controlled vocabulary for the parts of a genomic annotation. SO provides a common set of terms and definitions that will facilitate the exchange, analysis and management of genomic data." . [] a owl:Axiom ; rdfs:label "SO:[0-9]{7}" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_0601 ; owl:annotatedTarget "id-validation-regexp:" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0601 ; owl:annotatedTarget "so" . [] oboInOwl:hasDbXref "PMID:8238889" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0602 ; owl:annotatedTarget "Binding sites are identified by altered reactivity of a complex to a chemical treatment compared to the unbound molecules. Residues in close contact with the binding partner are protected from chemical modification. When these chemicals are administrated to intact cells, the pattern of protection from the probes identifies the location of DNA-protein or protein-protein interactions in vivo." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0602 ; owl:annotatedTarget "chemical footprint" . [] oboInOwl:hasDbXref "PMID:12057199", "PMID:12504676" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0069 ; owl:annotatedTarget "Mass spectrometric approaches to the study of macromolecular complexes permits the identification of subunit stoichiometry and transient associations. By preserving complexes intact in the mass spectrometer, mass measurement can be used for monitoring changes in different experimental conditions, or to investigate how variations of collision energy affect their dissociation." . [] oboInOwl:hasDbXref "PMID:8238889" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0603 ; owl:annotatedTarget "Dimethylsulphate (DMS) is the most commonly used chemical to study DNA-protein interactions. DMS induces methylation of guanine residues so DNA interaction with protein binding to AT rich sequences or to the phosphate backbone may be not detected by DMS footprinting. However as DMS diffuses across membrane it can also be used for in vivo footprinting. The experiment involves the treatment with DMS of two DNA samples with identical sequence, one protein bound and the other naked. The two samples are treated with piperidine to induce chemical cleavage of the DMS modified guanine residues followed by digestion with restriction enzymes. Once labelled the samples are run in parallel on a gel to visualize the pattern of nested fragments sharing a common end generated by restriction enzyme(or PCR primer extension) and a variable end guanine dependent. The missing bands of the protein bound sample correspond to the guanine residues protected from modification by an interaction." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0603 ; owl:annotatedTarget "dms footprinting" . [] oboInOwl:hasDbXref "PMID:8238889" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0604 ; owl:annotatedTarget "Potassium permanganate bind to single-stranded pyrimidine residues, it is commonly used to detect promoters opening regions in vivo. KMnO4 treatment of cells, followed by treatment with piperidine, followed by either PCR and/or acrylamide gel electrophoresis allows detection of interaction between transcription factor and the DNA sequence under their control." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0604 ; owl:annotatedTarget "k-mn-04 footprinting" . [] oboInOwl:hasDbXref "PMID:8238889" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0605 ; owl:annotatedTarget "Binding sites are identified by altered reactivity of a complex to an enzymatic probe compared to the unbound molecules. Residues in close contact with the binding partner are protected from cleavage by the enzyme. When these enzymes are administrated to intact cells, the pattern of protection from the probes identifies the location of DNA-protein or protein-protein interactions in vivo." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0605 ; owl:annotatedTarget "enzymatic footprint" . [] oboInOwl:hasDbXref "PMID:8238889" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0606 ; owl:annotatedTarget "Deoxyribonuclease I (DNase I) does not have high specificity for given sequences or residues, thus footprinting with DNase I permits the exact delineation of the protein-DNA binding site. Moreover DNase I, can be used for in vivo footprinting by treating intact cells with permeabilising drugs. In this latter case DNase I in vivo footprinting allow studies of the chromatin structure in genomic DNA." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0606 ; owl:annotatedTarget "dnase 1 footprinting" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0607 ; owl:annotatedTarget "These RNA molecules are relatively short (less than 200 nucleotides each), and there are five of them (U1, U2, U4, U5, and U6) involved in the major form of pre-mRNA splicing. Known as snRNAs (small nuclear RNAs), each is complexed with at least seven protein subunits to form a snRNP (small nuclear ribonucleoprotein). These snRNPs form the core of the spliceosome." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0607 ; owl:annotatedTarget "snRNA" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0069 ; owl:annotatedTarget "ms of complexes" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0607 ; owl:annotatedTarget "snrna" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0608 ; owl:annotatedTarget "RNA that is transcribed from the DNA of the nucleolus and is found, together with characteristic proteins, in the ribosomes." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0608 ; owl:annotatedTarget "rRNA" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0608 ; owl:annotatedTarget "rrna" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0609 ; owl:annotatedTarget "The small nucleolar RNAs, are stable RNA contained in the nucleoli and these RNAs exist as snoRNA: protein complexes called snoRNPs (also called 'snorps'). The snoRNPs function is in the maturation of ribosomal RNA and other RNAs, by: creating two types of modified nucleotides, (2'-O-methylated nucleotides and pseudouridine), and mediating endonucleolytic cleavages of pre-rRNA." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0609 ; owl:annotatedTarget "snoRNA" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0609 ; owl:annotatedTarget "snorna" . [] oboInOwl:hasDbXref "PMID:10542148" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0610 ; owl:annotatedTarget "Ribonucleic acid used in RNAi study. These RNA have the reverse complementary sequence of a target gene's mRNA transcript and inhibit its expression." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0610 ; owl:annotatedTarget "dicer RNA" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0610 ; owl:annotatedTarget "micro RNA" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0070 ; owl:annotatedTarget "Protein modifications can be identified by gel electrophoresis since any change in the mass and/or the charge of the protein can alter its mobility in PAGE. Although this method does not allow the unequivocal identification of the type of modification that has caused the shift, it is possible, by combining this approach with more direct methods, to correlate the extent of the shift to a specific modification." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0610 ; owl:annotatedTarget "siRNA" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0610 ; owl:annotatedTarget "sirna" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0611 ; owl:annotatedTarget "Small (300 nucleotides) stable RNAs transcribed by RNA pol III that are part of the signal-recognition particle (SRP). This particle comprises one RNA and six proteins bound to the RNA. SRP function is to assist secretory proteins sorting in the endoplasmic reticulum (ER). SRP is a cytosolic particle that transiently binds to the ER signal sequence of a nascent protein, to the large ribosomal unit, and to the SRP receptor in the ER membrane." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0611 ; owl:annotatedTarget "srpRNA" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0611 ; owl:annotatedTarget "srprna" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0612 ; owl:annotatedTarget "Comment for public view. This attribute can be associated to interaction, experiment, CV term, an organism and any participant." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0613 ; owl:annotatedTarget "Biological function of a participant or of an interaction." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0614 ; owl:annotatedTarget "URL/Web address describing an experiment, an interaction, a Cv term or an organism." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0615 ; owl:annotatedTarget "Search engine URL associated to Cv Database terms." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0616 ; owl:annotatedTarget "Example generally associated to Cv terms. Test." . [] oboInOwl:hasDbXref "PMID:7708014" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0071 ; owl:annotatedTarget "In sizing columns (gel filtration), the elution position of a protein or of a complex depends on its Stokes radius. Molecules with a radius that is smaller than the bead size are retained and retarded by the interaction with the matrix. The observation that two proteins, loaded on a sieving column, elute in a fraction(s) corresponding to a MW that is larger than the MW of either protein may be taken as an indication that the two proteins interact. Furthermore this technique provides a conceptually simple method for evaluating the affinity of the interaction." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0617 ; owl:annotatedTarget "The interaction has a known or demonstrated disease association." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0618 ; owl:annotatedTarget "Warning about errors or grounds for confusion. Can be associated to an interaction, experiment, CV term or any participant." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0619 ; owl:annotatedTarget "Refers to the metabolic or signalling pathway involving an interaction or a complex." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0620 ; owl:annotatedTarget "Search URL to retrieve an external entry in ASCII format. Generally associated to Cv Database terms." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0621 ; owl:annotatedTarget "Confidence classification assigned by the author of the publication to a specific interaction." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0622 ; owl:annotatedTarget "Description of confidence assessment method generally associated to the experiment." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0623 ; owl:annotatedTarget "The interaction between the proteins or the formation of a complex is disrupted by a biological molecule or by a modification of the interactors." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0624 ; owl:annotatedTarget "Reaction occurs at a faster rate in the presence of this compound or molecule i.e. the molecule directly physically co-operates with the interaction. Reaction may not occur at all in the absence of this molecule." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0625 ; owl:annotatedTarget "Any chemical applied externally to cells or any type of environmental condition, such as hypoxia, that stimulates an interaction, potentially by causing modification of one or more of the interactors." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0626 ; owl:annotatedTarget "Any chemical applied externally to cells or any type of environmental condition, such as hypoxia, that inhibits an interaction, potentially by alteration of amount or binding affinity of one or more of the interactors." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0071 ; owl:annotatedTarget "Gel Filtration" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0627 ; owl:annotatedTarget "Modifications of the standard experimental method described in the CV." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0627 ; owl:annotatedTarget "exp-modification" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0628 ; owl:annotatedTarget "Regular Expression used to check the validity of cross references' identifier. Attribute generally associated to terms in Cv Database." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0628 ; owl:annotatedTarget "id-validation-regexp" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0629 ; owl:annotatedTarget "Information on the complex being annotated. Attribute generally associated to an interaction." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0630 ; owl:annotatedTarget "Comments on the 3D structure. This attribute is generally associated to an interaction." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0631 ; owl:annotatedTarget "Free R-Factor and working R-Factor for the quality of the crystallographic model. This attribute is generally associated to an interaction." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0632 ; owl:annotatedTarget "Resolution of the 3D structure. This attribute is generally associated to an interaction." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0633 ; owl:annotatedTarget "Information about how the data was processed. This attribute is used mainly for large scale experiment." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0634 ; owl:annotatedTarget "E-mail address to contact the author or organisation which has produced the data. This attribute is generally associated to an experiment." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0071 ; owl:annotatedTarget "Size Exclusion Chromatography" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0635 ; owl:annotatedTarget "Free text notes on how to contact the author or organisation which has produced the data This attribute is generally associated to an experiment." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0636 ; owl:annotatedTarget "List of authors associated to a publication. This attribute is generally associated to an experiment." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0637 ; owl:annotatedTarget "Participant isoform's comment. This attribute can be attached to interactions or participants." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0638 ; owl:annotatedTarget "Post translational modification required for an interaction to occur." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0638 ; owl:annotatedTarget "prerequisite ptm" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0638 ; owl:annotatedTarget "prerequisite-ptm" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0638 ; owl:annotatedTarget "required ptm" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0638 ; owl:annotatedTarget "required-ptm" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0639 ; owl:annotatedTarget "Post translational modification occurs subsequently to an interaction." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0639 ; owl:annotatedTarget "resulting ptm" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0071 ; owl:annotatedTarget "Sizing column" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0639 ; owl:annotatedTarget "resulting-ptm" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0640 ; owl:annotatedTarget "Parameter for enzymatic or binding kinetic studies." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0641 ; owl:annotatedTarget "Molar concentration of an antagonist which produces 50% of the maximum possible inhibitory response for that antagonist. Note this measure depends on the specific antagonist used and upon experimental conditions, notably temperature, pH and solution composition (e.g., salts, chelating agents and others). Thus the ic50 is a relative measure and its values can be compared only when sharing the same experimental setting. Unit Molar." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0641 ; owl:annotatedTarget "IC50" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0642 ; owl:annotatedTarget "Molar concentration of an agonist which produces 50% of the maximum possible response for that agonist. Note this measure depends on the specific agonist used and upon experimental conditions, notably temperature, pH and solution composition (e.g., salts, chelating agents and others). Thus the ec50 is a relative measure and its values can be compared only when sharing the same experimental setting. Unit Molar." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0642 ; owl:annotatedTarget "EC50" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0643 ; owl:annotatedTarget "Equilibrium constant for dissociation of an inhibitor. Unit Molar." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0643 ; owl:annotatedTarget "Ki" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0644 ; owl:annotatedTarget "Michaelis-Menten constant: concentration of substrate at which the reaction rate is equal to half the maximal rate (i.e. Km={s} when Vo=1/2Vmax). Unit Molar." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0644 ; owl:annotatedTarget "Km" . [] oboInOwl:hasDbXref "PMID:7708014" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0007 ; owl:annotatedTarget "A specific antibody for the molecule of interest is not available, therefore the bait protein is expressed as a hybrid protein fused to a tag peptide/protein for which efficient and specific antibodies or a specific ligand are available." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0072 ; owl:annotatedTarget "Western blot assay carried out using monospecific antibodies produced in the supernatant of a cell line obtained by fusing a lymphocyte B to a myeloma cell line or selected by phage display technology." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0645 ; owl:annotatedTarget "The number of substrate molecules converted to product in a given unit of time, on a single enzyme molecule when the enzyme is saturated with substrate. Unit per second, or s-1." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0645 ; owl:annotatedTarget "turnover number" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0646 ; owl:annotatedTarget "The equilibrium dissociation constant of a receptor/ligand or proteinA/proteinB complex. Unit Molar (generally M-1)." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0646 ; owl:annotatedTarget "Kd" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0647 ; owl:annotatedTarget "Controlled vocabulary for kinetic constant units." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0648 ; owl:annotatedTarget "Molarity is the number of moles of solute dissolved in one liter of solution. The units, therefore are moles per liter, specifically it's moles of solute per liter of solution. These units are abbreviated as M and it means moles per liter (not just moles)." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0648 ; owl:annotatedTarget "M" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0649 ; owl:annotatedTarget "The second is the duration of 9 192 631 770 periods of the radiation corresponding to the transition between the two hyperfine levels of the ground state of the cesium-133 atom. The second was originally defined as 1/86 400 mean solar day until astronomers discovered that the mean solar day is actually not constant." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0649 ; owl:annotatedTarget "s" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0649 ; owl:annotatedTarget "sec" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0072 ; owl:annotatedTarget "monoclonal western" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0650 ; owl:annotatedTarget """10E-3 moles per liter of solution. OBSOLETE: term redundant with the schema exponent attribute of the parameter.""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0650 ; owl:annotatedTarget "mM" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0651 ; owl:annotatedTarget """10E-6 moles per liter of solution. OBSOLETE: term redundant with the schema exponent attribute of the parameter.""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0651 ; owl:annotatedTarget "uM" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0652 ; owl:annotatedTarget """10E-9 moles per liter of solution. OBSOLETE: term redundant with the schema exponent attribute of the parameter.""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0652 ; owl:annotatedTarget "nM" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0653 ; owl:annotatedTarget """10E-12 moles per liter of solution. OBSOLETE: term redundant with the schema exponent attribute of the parameter.""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0653 ; owl:annotatedTarget "pM" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0654 ; owl:annotatedTarget """10E-15 moles per liter of solution. OBSOLETE: term redundant with the schema exponent attribute of the parameter.""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0654 ; owl:annotatedTarget "fM" . [] oboInOwl:hasDbXref "PMID:11551470" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0073 ; owl:annotatedTarget "This method relies on the covalent coupling of mRNA to the nascent polypeptide. The mRNA (natural or artificial) is first covalently linked to a short DNA linker carrying a puromycin moiety. The mRNA mixture is then translated in vitro. When the ribosome reaches the RNA-DNA junction the ribosome stalls and the puromycin moiety enters the peptidyltransferase site of the ribosome and forms a covalent linkage to the nascent polypeptide. As a result the protein and the mRNA are covalently joined and can be isolated from the ribosome and purified. In the current protocol, a cDNA strand is then synthesised to form a less sticky RNA-DNA hybrid and these complexes are finally used for affinity selection. As in most display approaches, several selections cycles (3-6) are sufficient to enrich for mRNAs encoding ligand proteins." . [] oboInOwl:hasDbXref "PMID:15792953" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0655 ; owl:annotatedTarget "A protein of interest (the bait) is fused to the full-length bacteriophage lambda repressor protein (lambdacI, 237 amino acids), containing the amino terminal DNA-binding domain and the carboxylterminal dimerization domain. The corresponding target (prey) protein is fused to the N-terminal domain of the alfa-subunit of RNA polymerase (248 amino acids). The bait is tethered to the lambda operator sequence upstream of the reporter promoter through the DNA-binding domain of lambdacI. When the bait and prey interact, they recruit and stabilize the binding of RNA polymerase at the promoter and activate the transcription of the HIS3 reporter gene. Due to the tendency of both the lambda repressor protein and the N-terminal domain of the alfa-subunit of RNA polymerase to dimerize, this system might not be optimal for the analysis of proteins that self-associate unless their interaction with other protein partners depends on the oligomerization." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0655 ; owl:annotatedTarget "BacterioMatch" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0655 ; owl:annotatedTarget "lambda two hybrid" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0656 ; owl:annotatedTarget "Peptide whose sequence is experimentally identified and can lead to a full protein identification." . [] oboInOwl:hasDbXref "PMID:11539574" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0657 ; owl:annotatedTarget "RNA and cDNA constructs with variable central sequences and a constant flanking region are collected in a complex library. The library is then screened to select either specific binding partners of a bait molecule (generally a protein) or particular enzymatic activities of the nucleic acid molecules themselves. The selected nucleic acids are amplified using the constant flanking regions to increase their abundance. Cycles of selection-amplification can be repeated to increase the specificity of the targets that, at the end, are individually identified by sequencing." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0657 ; owl:annotatedTarget "in vitro evolution of nucleic acids" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0657 ; owl:annotatedTarget "selex" . [] oboInOwl:hasDbXref "PMID:11231557" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0658 ; owl:annotatedTarget "MudPIT is a method for rapid and large-scale protein identification by multidimensional liquid chromatography associated with tandem mass spectrometry. The chromatography step consists of strong cation exchange material back-to-back with reversed phase material inside fused silica capillaries. The peptides bound to the cation-exchange resin are freed by the gradually increasing salt concentration of the buffer and are subsequently retained by the reversed phase resin. Increasing buffers hydrophobicity progressively elute peptides from the reversed phase packing directly into the mass spectrometer. Typically this mass spectrometer will be a tandem electrospray, so peptides undergo ionization in the liquid phase, are separated in a primary mass spectrometer, analysed in the second mass spectrometer and identified." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0658 ; owl:annotatedTarget "mudpit" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0659 ; owl:annotatedTarget "Experimental method by which a feature is detected or identified." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0074 ; owl:annotatedTarget "Mutant molecules are produced by random or directed techniques and assayed for their ability to support binding." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0659 ; owl:annotatedTarget "exp feature detect" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0660 ; owl:annotatedTarget "Feature detection based on computational analysis." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0661 ; owl:annotatedTarget "experimental participant identification." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0661 ; owl:annotatedTarget "experimental particp" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0662 ; owl:annotatedTarget """IMEx primary identifier that is assigned to an experiment record by the database that created the record in the context of IMEx consortium. The identifiers are unique across all member database as they are all generated by a centralized key-assigner. http://imex.sourceforge.net/""" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0663 ; owl:annotatedTarget "A confocal is a standard epifluorescence microscope with improvement essentially coming from the rejection of out-of-focus light interference. Confocal imaging system achieves this by two strategies: a) by illuminating a single point of the specimen at any one time with a focused beam, so that illumination intensity drops off rapidly and b) by the use of blocking a pinhole aperture in a conjugate focal plane to the specimen so that light emitted away from the point in the specimen being illuminated is blocked from reaching the detector. Only the light from the single point illuminated of the specimen passing through the image pinhole is detected by a photodetector. Usually a computer is used to control the sequential scanning of the sample and to assemble the image for display onto a video screen." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0664 ; owl:annotatedTarget "Attribute name of annotation associated to an interaction element." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0664 ; owl:annotatedTarget "interaction att name" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0665 ; owl:annotatedTarget "Attribute name of annotation associated to an experiment element." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0665 ; owl:annotatedTarget "experiment att name" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0075 ; owl:annotatedTarget """The protein of interest is expressed as a fusion to the peptide EUKLISEED (a fragment of the Myc oncogene protein) for which antibodies are commercially available. Sometimes multiple copies of the peptide are fused in tandem. OBSOLETE redundant term. Map to feature type: myc-tagged (MI:0522) and Interaction detection method: anti tag coimmunoprecipitation (MI:0007).""" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0666 ; owl:annotatedTarget "Attribute name of annotation associated to a participant element." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0666 ; owl:annotatedTarget "participant att name" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0667 ; owl:annotatedTarget "Attribute name of annotation associated to a CV term." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0667 ; owl:annotatedTarget "cv att name" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0668 ; owl:annotatedTarget "Attribute name of annotation associated to a feature element." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0668 ; owl:annotatedTarget "feature att name" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0669 ; owl:annotatedTarget "Attribute name of annotation associated to an organism element." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0669 ; owl:annotatedTarget "organism att name" . [] oboInOwl:hasDbXref "PMID:22453911" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0670 ; owl:annotatedTarget "International Molecular Interaction Exchange." . [] a owl:Axiom ; rdfs:label "http://www.ebi.ac.uk/intact/imex/main.xhtml?query=${ac}" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_0670 ; owl:annotatedTarget "search-url:" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0075 ; owl:annotatedTarget "myc tag coip " . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0670 ; owl:annotatedTarget "IMEx" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0671 ; owl:annotatedTarget "This annotation topic should contain information about antibodies when specific antibodies (monoclonal or polyclonal raised against specific regions of the proteins or purified in a specific manner) have been used." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0672 ; owl:annotatedTarget "This annotation topic will be used to store information about the cDNA library. If a name is available this should be reported along with a short description of the library." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0673 ; owl:annotatedTarget "Alternative names to describe a complex." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0674 ; owl:annotatedTarget "Describe a cross reference pointing to a peptide parent sequence." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0674 ; owl:annotatedTarget "peptide-parent" . [] oboInOwl:hasDbXref "PMID:15221759" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0675 ; owl:annotatedTarget "IPI provides a top level guide to the main databases that describe the proteomes of higher eukaryotic organisms. IPI effectively maintains a database of cross references between the primary data sources, provides minimally redundant yet maximally complete sets of proteins for featured species (one sequence per transcript) and maintains stable identifiers (with incremental versioning) to allow the tracking of sequences in IPI between IPI releases. IPI is updated monthly in accordance with the latest data released by the primary data sources." . [] a owl:Axiom ; rdfs:label "IPI[0-9]+.[0-9]+|IPI[0-9]+" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_0675 ; owl:annotatedTarget "id-validation-regexp:" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0675 ; owl:annotatedTarget "ipi" . [] oboInOwl:hasDbXref "PMID:11403571" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0676 ; owl:annotatedTarget "Tandem affinity purification allows rapid purification under native conditions of complexes, even when expressed at their natural level. Prior knowledge of complex composition or function is not required. The TAP method requires fusion of the a multiple tag, either N- or C-terminally, to the target (or bait) protein of interest. The multiple tag allows two steps purification steps ensuring a highly selective complex purification." . [] oboInOwl:hasDbXref "PMID:11455607", "PMID:11874449" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0076 ; owl:annotatedTarget "Neural networks are trained on the properties of residues belonging to a cluster of residues that are neighbours in space on protein surface. The predictor permits the inference of the residues that are likely to be on an interaction interface." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0676 ; owl:annotatedTarget "TAP" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0676 ; owl:annotatedTarget "tap" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0677 ; owl:annotatedTarget "A tandem tag consists of the concatenation of simple distinct tags that is engineered to be cloned as a unique element onto a sequence of interest. Note that when a protein is fused to many simple tags that are inserted individually and possibly in different sequence positions these should be reported as independent features." . [] oboInOwl:hasDbXref "PMID:12454649" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0678 ; owl:annotatedTarget "A microarray consisting of antibodies spotted on a solid support in appropriate orientation is incubated with a biological sample (or antigen). Some proteins are captured by the antibodies in the array. Protein of forming complexes on the array are identified according to their prior labelling (tag, ELISA, biotin and others)." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0678 ; owl:annotatedTarget "antigen capture assay" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0678 ; owl:annotatedTarget "sandwich immunoassay" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0679 ; owl:annotatedTarget "A sequence of adenine nucleotides that is added to the 3' end of some primary transcript messenger RNA molecules in eukaryotes during post-transcriptional processing. The added tail is believed to confer stability to the molecule." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0679 ; owl:annotatedTarget "poly A" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0679 ; owl:annotatedTarget "poly a" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0680 ; owl:annotatedTarget "DNA that consists of only one chain of nucleotides rather than the two base pairing strands found in DNA in the double helix form." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0076 ; owl:annotatedTarget "interface predictor" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0680 ; owl:annotatedTarget "ss DNA" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0680 ; owl:annotatedTarget "ss dna" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0681 ; owl:annotatedTarget """DNA that consists of two base pairing strands. The 2 nucleotide chains are held together by hydrogen bonds between base pairs of nucleotides. """ . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0681 ; owl:annotatedTarget "ds DNA" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0681 ; owl:annotatedTarget "ds dna" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0682 ; owl:annotatedTarget "A cofactor is a small molecule required for the catalysis of an enzyme." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0682 ; owl:annotatedTarget "coenzyme" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0683 ; owl:annotatedTarget "Database collecting nucleic or amino acid sequences mainly derived from genomic or mRNA sequencing." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0684 ; owl:annotatedTarget "Molecule required for an observed binary interaction to occur. This molecule may act as stabilizer of any of the interaction partners or may act as a bridge molecule between them but the method does not provide resolution or evidence to demonstrate its actual molecular function (i.e.Mudpit, tri hybrid etc)." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0685 ; owl:annotatedTarget "Publication or document describing the originating resource where an interaction, or other curated information, was first described." . [] oboInOwl:hasDbXref "PMID:12062432", "PMID:12120505" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0077 ; owl:annotatedTarget "Nuclear magnetic resonance (NMR) is an effect whereby magnetic nuclei in a magnetic field absorb and re-emit electromagnetic (EM) energy. Certain atomic nuclei, and in particular hydrogen, have a magnetic moment or spin; i.e., they have an intrinsic magnetisation, like a bar magnet. The spin aligns along the strong magnetic field, but can be changed to a misaligned excited state in response to applied radio frequency (RF) pulses of electromagnetic radiation. When the excited hydrogen nuclei relax to their aligned state, they emit RF radiation, which can be measured and displayed as a spectrum. The nature of the emitted radiation depends on the environment of each hydrogen nucleus, and if one nucleus is excited, it will influence the absorption and emission of radiation by other nuclei that lie close to it. It is consequently possible, by an ingenious elaboration of the basic NMR technique known as two-dimensional NMR, to distinguish the signals from hydrogen nuclei in different amino acid residues and to identify and measure the small shifts in these signals that occur when these hydrogen nuclei lie close enough to interact: the size of such a shift reveals the distance between the interacting pair of hydrogen atoms. In this way NMR can give information about the distances between the parts of the interacting molecule. NMR provides information about interacting atoms thereby permitting to obtain information about macromolecular structure and molecular interactions." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0686 ; owl:annotatedTarget "Yet to be identified interaction detection method associated with interaction data imported from a third party database. This database may have potentially different standards of curation." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0687 ; owl:annotatedTarget "Protein having well characterized fluorescence excitation and emission spectra used as fusion with a protein under study to facilitate its localisation or identification." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0687 ; owl:annotatedTarget "fluorescent prot tag" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0688 ; owl:annotatedTarget "Part of a transcription factor responsible for the binding of gene regulatory region prior to their transcription. Such tags are generally used in two hybrid experiments where they are fused to a bait polypeptide tested for its ability to interact with a prey fused to an activation domain tag." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0688 ; owl:annotatedTarget "dna binding domain" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0689 ; owl:annotatedTarget "Part of a transcription factor responsible for the activation of DNA transcription. Such tags are generally used in two hybrid experiments where they are fused to a prey polypeptide tested for its ability to interact with a bait fused to a DNA binding domain tag." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0689 ; owl:annotatedTarget "activation domain" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0690 ; owl:annotatedTarget "Part of the yeast transcription factor GAL4 (amino acids 766-881) specifically responsible for DNA transcription activation." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0690 ; owl:annotatedTarget "gal4 ad" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0691 ; owl:annotatedTarget "Full viral protein vp16 exclusively responsible for preferential transcriptional activation of viral genes. Activation requires the formation of a complex with the host cell transcription factor." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0077 ; owl:annotatedTarget "NMR" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0691 ; owl:annotatedTarget "vp16 ad" . [] oboInOwl:hasDbXref "PMID:14613974" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0692 ; owl:annotatedTarget "B42 is an acidic sequence of 89 residues derived from Escherichia coli acting as weak transcription activation domain. When use in two hybrid experiments, the weakness of B42 as activator increases the sensitivity of the interaction detection." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0692 ; owl:annotatedTarget "b42 ad" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0693 ; owl:annotatedTarget """Part of the yeast transcription factor GAL4 (amino acids 11-38) specifically responsible for DNA binding of a 17 base-pair long sequence in the upstream activating sequence of galactose-induced genes. """ . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0693 ; owl:annotatedTarget "gal4 dna bd" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0694 ; owl:annotatedTarget "Amino terminal (1-220) part of the Escherichia coli lexA repressor, binding to 16 base pair palindromic DNA sequences." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0694 ; owl:annotatedTarget "lexa dna bd" . [] oboInOwl:hasDbXref "PMID:12454649" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0695 ; owl:annotatedTarget "Antibody array where proteins retained by the arrayed antibodies are identified using a detector antibody. The detector antibody is either modified with a directly detectable label (enzyme, fluorescent molecule, isotope, etc.), or it is biotinylated for detection after subsequent probing with labeled streptavidin." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0696 ; owl:annotatedTarget "Measures the catalysis of the transfer of a free nucleotidyl group to a nucleic acid chain." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0696 ; owl:annotatedTarget "nucleotidyltransferase assay" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0007 ; owl:annotatedTarget "anti tag coip" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0077 ; owl:annotatedTarget "nmr" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0697 ; owl:annotatedTarget "Measures the catalysis of the reaction: deoxynucleoside triphosphate + DNA(n) = diphosphate + DNA(n+1); the synthesis of DNA from deoxyribonucleotide triphosphates in the presence of a DNA template or primer." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0697 ; owl:annotatedTarget "dna dna pol assay" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0698 ; owl:annotatedTarget "Measures the catalysis of the reaction: nucleoside triphosphate + RNA(n) = diphosphate + RNA(n+1). Utilizes a DNA template, i.e. the catalysis of DNA-template-directed extension of the 3'-end of an RNA strand by one nucleotide at a time. Can initiate a chain 'de novo'." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0698 ; owl:annotatedTarget "dna rna pol assay" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0699 ; owl:annotatedTarget "Measures the catalysis of the reaction: deoxynucleoside triphosphate + DNA(n) = diphosphate + DNA(n+1). Catalyzes RNA-template-directed extension of the 3'- end of a DNA strand by one deoxynucleotide at a time." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0699 ; owl:annotatedTarget "rna dna pol assay" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0700 ; owl:annotatedTarget "Measures the catalysis of the reaction: nucleoside triphosphate + RNA (n) = diphosphate + RNA (n+1); uses an RNA template." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0700 ; owl:annotatedTarget "rna rna pol assay" . [] oboInOwl:hasDbXref "GO:0006271", "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0701 ; owl:annotatedTarget "The process by which a DNA strand is synthesized from template DNA by the action of polymerases, which add nucleotides to the 3' end of the nascent DNA strand." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0701 ; owl:annotatedTarget "DNA replication elongation " . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0078 ; owl:annotatedTarget "Identification of a nucleotide sequence. Depending on the experimental design, nucleotide sequence can be determined before the interaction detection while building a collection of clones or after the selection of randomly generated clones." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0701 ; owl:annotatedTarget "dna elongation" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0702 ; owl:annotatedTarget """The PANTHER (Protein ANalysis THrough Evolutionary Relationships) Classification System is a unique resource that classifies genes by their functions using published scientific experimental evidence and evolutionary relationships to predict function even in the absence of direct experimental evidence. www.pantherdb.org/""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0702 ; owl:annotatedTarget "PANTHER" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0703 ; owl:annotatedTarget """The Gene3D database provides a combined structural, functional and evolutionary view of the protein world. It is focused on providing structural annotation for protein sequences without structural representatives--including the complete proteome sets of over 240 different species. http://cathwww.biochem.ucl.ac.uk:8080/Gene3D/""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0703 ; owl:annotatedTarget "Gene3D" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0704 ; owl:annotatedTarget "Method by which nucleic acids are delivered or engineered into a cell." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0704 ; owl:annotatedTarget "nucl delivery" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0705 ; owl:annotatedTarget "Western blot assay performed when specific antibodies for the protein of interest are not available. Therefore the protein is expressed as a hybrid protein fused to a tag for which efficient antibodies are available. The antibody may be either monoclonal or polyclonal." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0705 ; owl:annotatedTarget "anti tag western" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0706 ; owl:annotatedTarget "Transformation is the genetic alteration of a cell resulting from the introduction, uptake and expression of foreign genetic material incorporated into the cell's genome (DNA or RNA)." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0078 ; owl:annotatedTarget "nucleotide sequence" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0706 ; owl:annotatedTarget "nucl transformation" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0707 ; owl:annotatedTarget "Immunostaining assay performed when specific antibodies for the protein of interest are not available. Therefore the protein is expressed as a hybrid protein fused to a tag peptide/protein for which efficient antibodies are available. The anti tag antibody may be either monoclonal or polyclonal." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0707 ; owl:annotatedTarget "anti tag immunost" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0708 ; owl:annotatedTarget "A monospecific antibody for the protein of interest is available, this is used to detect a specific protein within a cell or tissue sample." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0708 ; owl:annotatedTarget "monoclonal immunost" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0709 ; owl:annotatedTarget "Immunostaining assay carried out using a mixture of different antibodies that represent the immune response, normally in an experimental animal, to the protein of interest. These antibodies are used to detect the protein within a cell or tissue sample." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0709 ; owl:annotatedTarget "polyclonal immunost" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0710 ; owl:annotatedTarget "Stable introduction and expression of nucleic acid carried out by treatment with divalent cation." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0710 ; owl:annotatedTarget "n transformat cation" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0711 ; owl:annotatedTarget "Electroporation, or electropermeabilization, is a significant increase in the electrical conductivity and permeability of the cell plasma membrane caused by externally applied electrical field. It is usually used in molecular biology as a way of introducing some substance inside the cell, such as loading it with a molecular probe, a drug that can change cell's function, or a piece of coding DNA." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0078 ; owl:annotatedTarget "sequence cloning" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0711 ; owl:annotatedTarget "nucl electroporation" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0712 ; owl:annotatedTarget "Microinjection refers to the process of using a micro needle to insert substances at a microscopic level into a single living cell. It is a simple mechanical process in which an extremely fine micro needle penetrates the cell membrane and sometimes the nuclear envelope and releases nucleic acids." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0712 ; owl:annotatedTarget "nucl microinjection" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0713 ; owl:annotatedTarget "Nucleic acid entrance into cells that does not involved specific treatments but rely on natural cellular processes." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0713 ; owl:annotatedTarget "nucl passive uptake" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0714 ; owl:annotatedTarget "Transduction is the process by which bacterial DNA is moved from one bacterium to another by a virus." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0714 ; owl:annotatedTarget "nucl transduction" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0715 ; owl:annotatedTarget "Bacterial conjugation is the transfer of genetic material between bacteria through cell-to-cell contact. Bacterial conjugation is often incorrectly regarded as the bacterial equivalent of sexual reproduction or mating. It is not actually sexual, as it does not involve the fusing of gametes and the creation of a zygote. It is merely the transfer of a conjugative plasmid from a donor cell to a recipient" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0715 ; owl:annotatedTarget "nucl conjugation" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0716 ; owl:annotatedTarget "Entrance of molecules into cells that does not involved specific treatments but relies on natural cellular processes." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0079 ; owl:annotatedTarget """Experimental methods that could not be assigned to the other large group of technologies. OBSOLETE use biochemical (MI:0401) instead.""" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0717 ; owl:annotatedTarget "Lipofection (or liposome transfection) is a technique used to inject genetic material into a cell by means of liposomes which are vesicles that can easily merge with the cell membrane since they are both made of a phospholipid bilayer." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0717 ; owl:annotatedTarget "nucl lipotransfect" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0718 ; owl:annotatedTarget "Transient introduction and expression of nucleic acid carried out by treatment with chemicals." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0718 ; owl:annotatedTarget "n transfection treat" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0719 ; owl:annotatedTarget "Transient introduction and expression of nucleic acid carried out by treatment with calcium phosphate." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0719 ; owl:annotatedTarget "ca po nuc transfect" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0720 ; owl:annotatedTarget "Nucleic acid introduced into a cell via an external organism, usually a virus or bacteria.." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0720 ; owl:annotatedTarget "nucl infection" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0721 ; owl:annotatedTarget "Method by which proteins are delivered into a cell." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0722 ; owl:annotatedTarget "Method for temporarily permeabilising cell membranes in order to facilitate the entry of a protein." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0079 ; owl:annotatedTarget "other biochemic tech" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0722 ; owl:annotatedTarget "prot electroporation" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0723 ; owl:annotatedTarget "Microinjection refers to the process of using a micro needle to insert substances at a microscopic level into a single living cell. It is a simple mechanical process in which an extremely fine micro needle penetrates the cell membrane and sometimes the nuclear envelope and releases proteins." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0723 ; owl:annotatedTarget "prot microinjection" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0724 ; owl:annotatedTarget "Proteins are delivered into cells by treatment with cationic lipids." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0724 ; owl:annotatedTarget "prot cationic lipid" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0725 ; owl:annotatedTarget "Protein introduced into a cell via an external organism, usually a virus or bacteria." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0725 ; owl:annotatedTarget "prot infection" . [] oboInOwl:hasDbXref "PMID:8816797" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0726 ; owl:annotatedTarget "Yeast strains are generated in which expression of DB-X/AD-Y or DBPX hybrid proteins is toxic under particular conditions (negative selection). Under these conditions, dissociation of an interaction should provide a selective advantage thereby facilitating detection: a few growing yeast colonies in which DB-X/AD-Y (or DBPX/binding site) fail to interact should be identified among many nongrowing colonies containing interacting DB-X/AD-Y or DBPX/binding site." . [] oboInOwl:hasDbXref "PMID:14613974" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0727 ; owl:annotatedTarget "Yeast two-hybrid system using Escherichia coli LexA amino acids 1-202 as the DNA-binding domain (BD), E. coli B42 acidic sequence as the activation domain (AD), and two reporters, lacZ and LEU2, each containing upstream LexA binding elements." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0727 ; owl:annotatedTarget "LexA B52 transcription complementation" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0080 ; owl:annotatedTarget "Genes are recognised by hybridization of a probe with a fragment of the gene sequence." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0727 ; owl:annotatedTarget "lexa b52 complement" . [] oboInOwl:hasDbXref "PMID:1387709" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0728 ; owl:annotatedTarget "A chimeric protein consisting of the GAL4 DNA-binding domain (aa 1-147 of GAL4) and a transcriptional activation domain from the herpes simplex virus protein VP16 (either aa 411-490 or aa 411-455) can specifically activate transcription of a reporter gene located downstream ofGAL4 DNA binding sites and the E1B minimal promoter. Similarly, two chimeric proteins, one encoding a chimeric GAL4 protein and the other encoding a chimeric VP16 protein, can activate the reporter gene, if the domains fused to the GAL4 and VP16 sequences can complex with appropriate conformation. However, if the domains fused to the GAL4 and VP16 sequences do not interact specifically to form a + complex that reconstitutes GAL4 function, the reporter gene cannot be activated." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0728 ; owl:annotatedTarget "KISS" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0728 ; owl:annotatedTarget "gal4 vp16 complement" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0728 ; owl:annotatedTarget "karyoplasmic interaction ion strategy" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0728 ; owl:annotatedTarget "mammalian two hybrid" . [] oboInOwl:hasDbXref "PMID:15761153" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0729 ; owl:annotatedTarget "This strategy uses a luciferase enzyme fused to proteins of interest, which are then coexpressed with individual epitope-tagged partners in mammalian cells. Their interactions are determined by performing an enzymatic assay on anti-tag immunoprecipitates." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0729 ; owl:annotatedTarget "lumier" . [] oboInOwl:hasDbXref "PMID:16381840" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0730 ; owl:annotatedTarget """PubChem provides information on the biological activities of small molecules. http://pubchem.ncbi.nlm.nih.gov/""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0730 ; owl:annotatedTarget "PubChem" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0080 ; owl:annotatedTarget "partial dna sequence hybrid" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0731 ; owl:annotatedTarget "The aim of 3D Repertoire is to determine the structures of all amenable complexes in a cell at medium or high resolution, which will later serve to integrate in toponomic and dynamic analyses of protein complexes in a cell. Complex models, EM pictures, expression and purification protocols obtained in the project will be collected in a database connected to the PDB repository." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0731 ; owl:annotatedTarget "3D Repertoire" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0732 ; owl:annotatedTarget "The red fluorescent protein derived from, for example, marine anemone Discosoma striata and reef corals belonging to the class Anthozoacan can be fused to individual proteins which then acquire fluorescence excitation and emission spectra virtually identical to those of the native." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0732 ; owl:annotatedTarget "RFP" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0732 ; owl:annotatedTarget "red fluorescent protein" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0732 ; owl:annotatedTarget "rfp tag" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0733 ; owl:annotatedTarget "The cyan fluorescent protein derived from Anthozoa reef coral can be fused to individual proteins which then acquire fluorescence excitation and emission spectra virtually identical to those of the native." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0733 ; owl:annotatedTarget "CFP" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0733 ; owl:annotatedTarget "cfp tag" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0733 ; owl:annotatedTarget "cyan fluorescent protein" . [] oboInOwl:hasDbXref "PMID:11167074" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0081 ; owl:annotatedTarget "The peptide synthesis methods offer numerous opportunities to synthesise and subsequently screen large arrays of synthetic peptides on planar cellulose supports. Discrete spots are arranged as arrays on membrane sheets where each spot is individually accessed by manual or automated delivery of the appropriate reagent solutions. Over the past few years protein-protein recognition, peptide-metal ion interactions, peptide-nucleic acid binding, enzymatic modification of peptides experiments, have been explored using synthetic peptide arrays on planar support." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0734 ; owl:annotatedTarget "Variation of the green fluorescent protein derived from the bioluminescent jellyfish Aequorea victoria, can be fused to individual proteins which then acquire fluorescence excitation and emission spectra virtually identical to those of the native." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0734 ; owl:annotatedTarget "EGFP" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0734 ; owl:annotatedTarget "egfp tag" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0734 ; owl:annotatedTarget "enhanced green fluorescent protein" . [] oboInOwl:hasDbXref "PMID:8290579" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0735 ; owl:annotatedTarget "Tag derived from the transactivating (Tat) protein of human immunodeficiency virus 1 (HIV-1) that can enter cells efficiently when added exogenously in tissue culture. The Tat tag can carry other molecules into cells, by fusion of Tat peptides (residues 1-72 or 37-72,) to any molecule under study. Tat-mediated uptake may allow the delivery of macromolecules previously thought to be impermeable to living cells." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0735 ; owl:annotatedTarget "Tat tag" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0735 ; owl:annotatedTarget "tat tag" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0736 ; owl:annotatedTarget "Proteins entrance into cells that does not involved specific treatments but rely on natural cellular processes." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0736 ; owl:annotatedTarget "prot passive uptake" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0737 ; owl:annotatedTarget "database storing sequences detected by peptide identification methods." . [] oboInOwl:hasDbXref "PMID:10967324", "PMID:11752590", "PMID:11805826" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0082 ; owl:annotatedTarget "This approach leads to protein identification by matching peptide masses, as measured by mass spectrometry, to the ones calculated from in silico fragmentation of a protein sequence database. A peptide mixture from a tryptic digest is analysed by MALDI-MS (Matrix-assisted laser desorption ionization mass spectrometry). The list of peptide masses obtained by MALDI MS is automatically compared to the calculated masses of the predicted peptide fragments for each entry in the database. High mass accuracy is very important in order to obtain a statistically significant and unambiguous match This method is best applied to completely sequenced genomes and well characterised proteomes. However, depending on the data quality, proteins that are highly homologous to already characterised proteins (greater than 80 to 90% sequence identity) can also be identified. The retrieved sequence are evaluated by mass accuracy of the peptides, matching of additional peptide masses in the MALDI spectrum after accounting for common modifications such as oxidation, acrylamidation of cysteine and missed cleavages and the use of secondary information (apparent isoelectric point and molecular weight). If any ambiguity about the identification by MALDI-MS still exists, the results must verified by an other identification method. Peptide mass fingerprint is generally carried out with a MALDI-TOF (Matrix-assisted laser desorption ionization time-of-flight ) instrument but can also be achieved ESI-TOF (Electrospray Ionisation time-of-flight) or LC-MS (Liquid Chromatography-Mass Spectrometry) mass spectrometer." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0737 ; owl:annotatedTarget "pep seq db" . [] oboInOwl:hasDbXref "PMID:16381953" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0738 ; owl:annotatedTarget """PRIDE is a public repository of protein and peptide identifications for the proteomics community. http://www.ebi.ac.uk/pride/""" . [] a owl:Axiom ; rdfs:label "http://www.ebi.ac.uk/pride/archive/projects/${ac}" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_0738 ; owl:annotatedTarget "search-url:" . [] oboInOwl:hasDbXref "PMID:16574060" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0739 ; owl:annotatedTarget "Membrane shuttling peptide derived from the Drosophila homeobox protein Antennapedia: RQIKIWFQNRRMKWKK" . [] oboInOwl:hasDbXref "PMID:16574060" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0740 ; owl:annotatedTarget "The peptides named CPPs vary greatly in size, amino acid sequence, and charge, but share the common feature that they have the ability to rapidly translocate the plasma membrane and enable delivery to the cytoplasm or nucleus." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0740 ; owl:annotatedTarget "CPPs" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0740 ; owl:annotatedTarget "MTS" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0740 ; owl:annotatedTarget "PTDs" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0740 ; owl:annotatedTarget "Trojan peptides" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0740 ; owl:annotatedTarget "cell penetrating pep" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0008 ; owl:annotatedTarget "In this class of methodologies, the molecules to be tested are presented ordered in an array format (typically at high density) on planar supports. The characteristics and chemical nature of the planar support can vary. This format permits the simultaneous assay, in controlled conditions, of several thousand proteins/peptides/nucleic acids for different functions, for instance their ability to bind any given molecule." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0082 ; owl:annotatedTarget "fingerprinting" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0740 ; owl:annotatedTarget "cell-penetrating peptides" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0740 ; owl:annotatedTarget "membrane translocating sequences" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0740 ; owl:annotatedTarget "protein transduction domains" . [] oboInOwl:hasDbXref "PMID:15642101", "PMID:16381952" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0741 ; owl:annotatedTarget """PeptideAtlas addresses these needs by identifying peptides by tandem mass spectrometry (MS/MS), statistically validating those identifications and then mapping identified sequences to the genomes of eukaryotic organisms. http://www.peptideatlas.org/""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0741 ; owl:annotatedTarget "PeptideAtlas" . [] oboInOwl:hasDbXref "PMID:15595733" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0742 ; owl:annotatedTarget """Global Proteome Machine aim to improve the quality of analysis, make the results portable and to provide a common platform for testing and validating proteomics results. http://www.thegpm.org""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0742 ; owl:annotatedTarget "Global Proteome Machine" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0787 ; owl:annotatedTarget "Descriptor of an experimental form involved in a genetic interaction" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0787 ; owl:annotatedTarget "genetic exp form" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0788 ; owl:annotatedTarget "The gene has been completely removed e.g. by genetic engineering " . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0083 ; owl:annotatedTarget "When one of the partners participates in the interaction with a relatively short peptide fragment, it is often convenient to precisely identify the minimal region that supports the interaction by synthesising a series of overlapping peptides and by testing them in the binding assay. Synthetic peptides that are identical with peptides synthesised in vivo are useful experimental tools for such studies. Peptides are routinely synthesised in a test tube from monomeric amino acids by condensation reactions that form peptide bonds. Peptides are constructed sequentially by coupling the C-terminus of a monomeric amino acid to the N-terminus of the growing peptide. To prevent unwanted reactions involving the amino groups and carboxyl groups of the side chains during the coupling steps, a protecting (blocking) group is attached to the side chains. Without these protecting groups, branched peptides would be generated. In the last steps of synthesis, the side chain-protecting groups are removed and the peptide is cleaved from the resin on which synthesis occurs." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0788 ; owl:annotatedTarget "knock-out" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0789 ; owl:annotatedTarget "The gene expression has been significantly reduced compared to wild-type by introduction of an external substance, e.g. by RNA interference." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0789 ; owl:annotatedTarget "knock-down" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0790 ; owl:annotatedTarget "The gene function has been partially improved compared to wild-type by altering its sequence." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0791 ; owl:annotatedTarget "The gene function has been partially reduced compared to wild-type by altering its sequence e.g. a temperature sensitive mutant." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0792 ; owl:annotatedTarget "The gene function has been antagonized by a mutation in another copy of the gene." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0793 ; owl:annotatedTarget "The gene function has been abolished by mutation, though the type of mutation is not known." . [] oboInOwl:hasDbXref "PMID:15833125" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0794 ; owl:annotatedTarget """An effect in which two genetic perturbations, when combined, result in a mutant phenotype that is not observed (or minimally observed) as a result of any of the individual perturbations. wt = a = b = E (not=) ab""" . [] oboInOwl:hasDbXref "PMID:15833125" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0795 ; owl:annotatedTarget """An effect in which individual perturbations of different genes and their combination result in the same mutant phenotype, to the same degree of severity/penetrance. With respect to any single quantifiable phenotype, this may be expressed as an inequality as: a = b = ab != wt where 'a' and 'b' are the observed phenotype values of the individual perturbations, 'ab' is the observed phenotype value of the double perturbation, and 'wt' is the wild type phenotype value.""" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0795 ; owl:annotatedTarget "asynthetic" . [] oboInOwl:hasDbXref "PMID:10975452", "PMID:7708014" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0084 ; owl:annotatedTarget "Peptide sequences or entire proteins can be displayed on phage capsids by fusion to coat proteins to generate a library of fusion phages each displaying a different peptide. Such a library can then be exploited to identify specific phages that display peptides that bind to any given bait molecule for instance an antibody. The selection is performed by a series of cycles of affinity purification known as panning. The bait protein, immobilized on a solid support (plastic, agarose, sepharose, magnetic beads and others) is soaked in the phage mixture and that phage that remains attached to the bait is amplified and carried through a further affinity purification step. Each cycle results in an approximately 1,000-fold enrichment of specific phage and after a few selection rounds (2-4), DNA sequencing of the tight-binding phage reveals only a small number of sequences. Phage display panning experiments can be carried out either on libraries of peptides of random amino acid sequence or on libraries of displaying natural peptides obtained by inserting cDNA fragments into the phage vector (cDNA libraries). Libraries have been assembled on several different phages (Fd, Lambda or T7)." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0795 ; owl:annotatedTarget "asynthetic genetic interaction (sensu inequality)" . [] oboInOwl:hasDbXref "PMID:18305163" ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0795 ; owl:annotatedTarget "coequal genetic interaction" . [] oboInOwl:hasDbXref "PMID:15833125" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0796 ; owl:annotatedTarget """An effect in which two genetic perturbations, when combined, result in a phenotype that is less severe/penetrant than the most severe phenotype of the original perturbations, in effect making the organism more \"wild type\" in character with regards to the phenotype in question. With respect to any single quantifiable phenotype, this may be expressed as an inequality as: a* < ab <= wt [E = a*] OR wt <= ab < a* [E = a*] where 'a*' is the most severe observed phenotype value of the individual perturbations, 'ab' is the observed phenotype value of the double perturbation, 'E' is the expected phenotype value of the double perturbation, and 'wt' is the wild type phenotype value.""" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0796 ; owl:annotatedTarget "suppression" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0796 ; owl:annotatedTarget "suppressive genetic interaction (sensu inequality)" . [] oboInOwl:hasDbXref "PMID:15833125" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0797 ; owl:annotatedTarget """An effect in which individual perturbations of two different genes result in different mutant phenotypes, and the resulting phenotype of their combination (the double mutant) is equal to that of only one of the perturbations. With respect to any single quantifiable phenotype, this may be expressed as an inequality as: (a != wt AND b != wt AND a != b) AND (ab = a OR ab = b) where 'a' and 'b' are the observed phenotype values of the individual perturbations, 'ab' is the observed phenotype value of the double perturbation, 'wt' is the wild type phenotype value and 'a != b' indicates qualitatively or quantitatively different phenotypes.""" . [] oboInOwl:hasDbXref "PMID:17510664", "https://archive.org/details/mendelsprinciple00bate/page/n8" ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0797 ; owl:annotatedTarget "Bateson genetic epistasis" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0797 ; owl:annotatedTarget "epistatic" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0797 ; owl:annotatedTarget "epistatic genetic interaction (sensu inequality)" . [] oboInOwl:hasDbXref "PMID:15833125" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0798 ; owl:annotatedTarget "The phenotype resulting from genetic perturbation of A has an effect only in the b background, or the b mutant has an effect only in the a background. a has an effect only in the b background, or the b mutant has an effect only in the a background. E. g., WT = a > ab > b or WT > a > b > ab." . [] oboInOwl:hasDbXref "PMID:10200254" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0085 ; owl:annotatedTarget "The phylogenetic profile of a protein stores information about the presence and the absence of that protein in a set of genomes. By clustering identical or similar profiles, proteins with similar functions and potentially interacting are identified." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0798 ; owl:annotatedTarget "conditional" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0798 ; owl:annotatedTarget "conditional genetic interaction (sensu inequality)" . [] oboInOwl:hasDbXref "PMID:15833125" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0799 ; owl:annotatedTarget "Single-mutant phenotype effects combine to give a double-mutant effect different from the wild type and different from single mutant effect. For instance, WT < a = b < ab, b < WT = ab < a, WT < a < b < ab, b < WT < ab < a, and all additional inequalities obtained by interchanging a and b, or reversing the effect of both a and b." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0799 ; owl:annotatedTarget "additive" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0799 ; owl:annotatedTarget "additive genetic interaction (sensu inequality)" . [] oboInOwl:hasDbXref "PMID:15833125" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0800 ; owl:annotatedTarget "The phenotype resulting from genetic perturbation of B shows opposing effects in the WT and a backgrounds (for example, b > WT and ab < a); or, a shows opposing effects in the WT and b backgrounds, but not both. E.g., WT > a > ab > b." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0800 ; owl:annotatedTarget "single nonmonotonic" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0800 ; owl:annotatedTarget "single nonmonotonic genetic interaction (sensu inequality)" . [] oboInOwl:hasDbXref "PMID:15833125" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0801 ; owl:annotatedTarget "The phenotype resulting from genetic perturbation of both A and B show opposing effects in the WT background and the background with the other mutant gene. E.g., WT >= ab > a >= b" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0801 ; owl:annotatedTarget "double nonmonotonic" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0086 ; owl:annotatedTarget "Western blot assay carried out using a mixture of different antibodies that represent the immune response, normally in an experimental animal, to the protein of interest." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0801 ; owl:annotatedTarget "double nonmonotonic genetic interaction (sensu inequality)" . [] oboInOwl:hasDbXref "PMID:15833125" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0802 ; owl:annotatedTarget """The A genetic perturbation enhances the phenotype of the B perturbation, or vice versa (e.g. WT = A < B < AB or WT = B < A < AB). This could be conditional or additive by the above scheme. OBSOLETE: remap to MI:0933 'negative genetic interaction'""" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0802 ; owl:annotatedTarget "enhancement" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0803 ; owl:annotatedTarget "Synthesis rate of a molecule under investigation differs from its naturally occurring expression level in a cell." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0803 ; owl:annotatedTarget "expression modif" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0804 ; owl:annotatedTarget "The gene is mutated in some unknown manner" . [] oboInOwl:hasDbXref "PMID:14634627" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0805 ; owl:annotatedTarget """The Worldwide Protein Data Bank (wwPDB) consists of organizations that act as deposition, data processing and distribution centers for PDB data. The founding members are RCSB PDB (USA), MSD-EBI (Europe) and PDBj (Japan). The BMRB (USA) group joined the wwPDB in 2006. The mission of the wwPDB is to maintain a single Protein Data Bank Archive of macromolecular structural data that is freely and publicly available to the global community. http://www.wwpdb.org/""" . [] a owl:Axiom ; rdfs:label "[0-9][a-zA-Z0-9]{3}" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_0805 ; owl:annotatedTarget "id-validation-regexp:" . [] a owl:Axiom ; rdfs:label "http://www.pdbe.org/${ac}" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_0805 ; owl:annotatedTarget "search-url:" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0805 ; owl:annotatedTarget "wwPDB" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0086 ; owl:annotatedTarget "polyclonal western" . [] oboInOwl:hasDbXref "PMID:12099029" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0806 ; owl:annotatedTarget """PDBj(Protein Data Bank Japan) maintains the database for the protein structures with financial assistance from the Institute for Bioinformatics Research and Development of Japan Science and Technology Corporation(BIRD-JST), collaborating with the Research Collaboration for Structural Bioinformatics(RCSB) and the MSD in the European Bioinformatics Institute(MSD-EBI) in EU. All three organizations serve as deposition, data processing and distribution sites. http://www.pdbj.org/""" . [] a owl:Axiom ; rdfs:label "[0-9][a-zA-Z0-9]{3}" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_0806 ; owl:annotatedTarget "id-validation-regexp:" . [] a owl:Axiom ; rdfs:label "http://pdbjs3.protein.osaka-u.ac.jp/xPSSS/DetailServlet?PDBID=${ac}&PAGEID=Summary" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_0806 ; owl:annotatedTarget "search-url:" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0806 ; owl:annotatedTarget "PDBj" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0807 ; owl:annotatedTarget "The interaction of two or more molecules is determined by their very close proximity or the overlap of their respective bands in a gel." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0807 ; owl:annotatedTarget "comigration in gel" . [] oboInOwl:hasDbXref "PMID:14755292", "PMID:16732283" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0808 ; owl:annotatedTarget "A method allowing the detection of strong interactions between two or more molecules as running, all of them, within a single band in a denaturing gel." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0808 ; owl:annotatedTarget "comigration in sds" . [] oboInOwl:hasDbXref "PMID:11983170" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0809 ; owl:annotatedTarget "The bimolecular fluorescence complementation (BiFC) is an assay for determination of protein interactions and/or their location in living cells. This approach is based on complementation between two non- fluorescent fragments of a protein fluorophore such as green fluorescent protein (GFP) or its derivatives. Interactions between proteins fused to each fragment bring the fragments together resulting in the reconstitution of a fully functional flourophore that can be identified through fluorescence spectroscopy or microscopy." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0809 ; owl:annotatedTarget "bifc" . [] oboInOwl:hasDbXref "PMID:11791231" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0087 ; owl:annotatedTarget "Methods based on natural language processing to detect possible interactions between proteins (direct physical interactions or indirect genetic interactions). This includes the detection of non ambiguous protein or gene names and analysis of the relation expressed in a sentence among them." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0810 ; owl:annotatedTarget "In this approach, once a molecule is demonstrated to participate in an interaction, several substitution mutants are produced and tested in the binding assay to identify the residues which identity is crucial for the interaction." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0810 ; owl:annotatedTarget "substitut analysis" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0811 ; owl:annotatedTarget "In this approach, once a molecule is demonstrated to participate in an interaction, several insertion derivatives are produced and tested in the binding assay to detect the regions that are important for the interaction." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0812 ; owl:annotatedTarget "The protein is expressed and purified as a fusion to the calmoduling-binding protein. The fusion protein can be purified by affinity chromatography using a calmodulin resin." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0812 ; owl:annotatedTarget "cam tag" . [] oboInOwl:hasDbXref "PMID:15155907", "PMID::17072308" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0813 ; owl:annotatedTarget "Upon binding of two proximity probes (usually antibodies conjugated to DNA) to the same target protein complex, the oligonucleotides on the proximity probes are brought close together. These antibody-conjugated oligonucleotides hybridize to two connector oligonucleotides that are ligated to form a circular DNA molecule. This newly formed DNA-molecule can be amplified by rolling circle amplification. The resulting single-stranded DNA-molecule collapses into a bundle, which is detectable through hybridization of fluorescently labeled complementary oligonucleotides." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0813 ; owl:annotatedTarget "PLA" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0813 ; owl:annotatedTarget "pELISA" . [] oboInOwl:hasDbXref "PMID:16615907" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0814 ; owl:annotatedTarget "In protease accessibility laddering (PAL) tagged proteins are purified on magnetic beads in their natively folded state. While attached to the beads, proteins are probed with proteases. Proteolytic fragments are eluted and detected by immunoblotting with antibodies against the tag (e.g., Protein A, GFP, and 6xHis)." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0814 ; owl:annotatedTarget "pal" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0087 ; owl:annotatedTarget "predictive tm" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0814 ; owl:annotatedTarget "protease access" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0815 ; owl:annotatedTarget "Molecule whose sequence identity is derived from their molecular weight" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0815 ; owl:annotatedTarget "weight identificat" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0816 ; owl:annotatedTarget "Molecule whose sequence identity is derived from their molecular weight after a comigration in a gel with molecular weight marker." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0816 ; owl:annotatedTarget "weight by staining" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0817 ; owl:annotatedTarget "Molecule whose sequence identity is derived from their molecular weight after a comigration in a gel with molecular weight marker and staining of the molecules with silver." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0817 ; owl:annotatedTarget "weight silver stain" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0818 ; owl:annotatedTarget "Molecule whose sequence identity is derived from their molecular weight after a comigration in a gel with molecular weight marker and staining of the molecules with comassie dye." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0818 ; owl:annotatedTarget "weight by comassie" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0819 ; owl:annotatedTarget "Molecule whose sequence identity is derived from their molecular weight after a comigration in a gel with molecular weight marker and staining of the molecules with bromide dyes." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0088 ; owl:annotatedTarget "Sequences can be identified in a DNA mixture by launching a PCR (Polymerase Chain Reaction) controlled by sequence specific primers. Such reaction starts only when the hybridization of the primer with a complementary sequence occurs." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0819 ; owl:annotatedTarget "weight by bromide" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0820 ; owl:annotatedTarget "Molecule whose sequence identity is derived from their molecular weight after a comigration in a gel with molecular weight marker and staining of the molecules with sybr dyes." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0820 ; owl:annotatedTarget "safe DNA gel stain" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0820 ; owl:annotatedTarget "weight by sybr" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0821 ; owl:annotatedTarget "Molecule whose sequence identity is derived from their molecular weight after a comigration in a gel with molecular weight marker and staining by autoradiography." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0821 ; owl:annotatedTarget "weight autoradiogra" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0822 ; owl:annotatedTarget "Molecule whose sequence identity is derived from their molecular weight after a comigration in a gel with molecular weight marker and staining of the molecules with Hoechst dyes." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0822 ; owl:annotatedTarget "weight by hoechst" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0823 ; owl:annotatedTarget "Feature detection not verified in the context of an experiment but assumed from external or previous experimental evidence(s)." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0823 ; owl:annotatedTarget "predetermined featur" . [] oboInOwl:hasDbXref "PMID:10976071", "PMID:12067604" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0089 ; owl:annotatedTarget "The protein array technology allows the screening of biochemical activities or binding abilities of hundreds or thousands of protein samples in parallel. After synthesis and purification by high-throughput methodologies, the proteins are printed onto the chip by using an instrument (micro-arrayer) that is capable of spotting liquid samples in a reproducible manner onto a planar support. The ordered protein array can then be probed with labelled molecules to identify proteins that bind to the bait." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0824 ; owl:annotatedTarget "Analysis of a diffraction pattern generated by an isotropic sample composed of many randomly oriented crystals." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0824 ; owl:annotatedTarget "X-ray" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0824 ; owl:annotatedTarget "x-ray powder diffrac" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0825 ; owl:annotatedTarget "Analysis of the diffraction pattern of a partially ordered sample composed of fibers oriented parallel to each other using X-ray." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0825 ; owl:annotatedTarget "X-ray" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0825 ; owl:annotatedTarget "x-ray fiber diffrac" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0826 ; owl:annotatedTarget "Method where the internal structure of a sample is derived from the intensity distribution of the scattered monochromatic X-ray beam at very low scattering angles." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0826 ; owl:annotatedTarget "saxs" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0827 ; owl:annotatedTarget "X-ray Tomography is a branch of X-ray microscopy. A series of projection images are used to calculate a three dimensional reconstruction of an object. The technique has found many applications in materials science and later in biology and biomedical research. In terms of the latter, the National Center for X-ray Tomography (NCXT) is one of the principle developers of this technology, in particular for imaging whole, hydrated cells." . [] oboInOwl:hasDbXref "PMID:14577292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0828 ; owl:annotatedTarget "Subpart of a polyprotein that is naturally cleaved in vivo." . [] oboInOwl:hasDbXref "PMID:10436088", "PMID:8248129" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0009 ; owl:annotatedTarget "The protein of interest is presented on the outer membrane of Gram negative bacteria by expressing it as a fusion partner to peptide signals that direct heterologous proteins to the cell surface. For instance, a single chain Fv (scFv) antibody fragment, consisting of the variable heavy and variable light domains from two separate anti-digoxin monoclonal antibodies, was displayed on the outer membrane of Escherichia coli by fusing it to an Lpp-OmpA. Similar systems have also been developed for gram positive bacteria. Fluorescence-activated cell sorting (FACS), is used to specifically select clones displaying a protein binding to scFv-producing cells." . [] oboInOwl:hasDbXref "PMID:11495741" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0090 ; owl:annotatedTarget "In the protein-fragment complementation assay, the proteins of interest (\"Bait\" and \"Prey\") are covalently linked at the genetic level to incomplete fragments of a third protein (known as the \"reporter\") and are expressed in vivo, Interaction between the \"bait\" and the \"prey\" proteins brings the fragments of the \"reporter\" protein in close enough proximity to allow them to reform and become the functional reporter protein. Typically enzymes which confer resistance to antibiotics, such as Dihydrofolate reductase or Beta-lactamase, or proteins that give colorimetric or fluorescent signals are used. The Bait protein is generally the protein under study and the methods are readily adaptable to highthroughput mode." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0828 ; owl:annotatedTarget "polyprotein frag" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0829 ; owl:annotatedTarget "This qualifier is used for hybrid or composite molecules with more than one cross-reference to parent molecules." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0829 ; owl:annotatedTarget "multiple parent" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0830 ; owl:annotatedTarget """List of tissue used as topic in UniProt RC line. http://www.expasy.org/cgi-bin/lists?tisslist.txt""" . [] oboInOwl:hasDbXref "PMID:16381901" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0831 ; owl:annotatedTarget """Ontology of cell types. http://obo.sourceforge.net/cgi-bin/detail.cgi?cell""" . [] oboInOwl:hasDbXref "MOD:00798", "RESID:AA0025" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0832 ; owl:annotatedTarget "A protein modification that is effectively either one half of a cystine cross-link, or a cysteine residue with one hydrogen atom or proton removed" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0832 ; owl:annotatedTarget "Half of a disulfide bridge" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0833 ; owl:annotatedTarget "Experimental method by which radiolabel is detected by exposure to a photographic emulsion forming a pattern on the film." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0834 ; owl:annotatedTarget "Association rate constant or rate of complex formation. Unit MOLE per SECOND (M-1 s-1)" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0834 ; owl:annotatedTarget "kon" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0090 ; owl:annotatedTarget "PCA" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0835 ; owl:annotatedTarget "Dissociation rate constant measuring the stability of a complex. Unit SECOND (s-1)" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0835 ; owl:annotatedTarget "koff" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0836 ; owl:annotatedTarget "Temperature at which interaction was determined. Unit KELVIN (K)" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0836 ; owl:annotatedTarget "T interaction" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0836 ; owl:annotatedTarget "Tint" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0836 ; owl:annotatedTarget "temp interaction" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0837 ; owl:annotatedTarget "pH at which interaction was determined." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0837 ; owl:annotatedTarget "pHint" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0838 ; owl:annotatedTarget "The kelvin (K) is the SI unit of thermodynamic temperature. It is defined by taking the fixed numerical value of the Boltzmann constant k to be 1.380649×10-23 when expressed in the unit J·K-1, which is equal to kg·m2·s-2·K-1, where the kilogram, metre and second are defined in terms of h, c and caesium frequency. It is equivalent to -273.15°C / -459.67°F." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0838 ; owl:annotatedTarget "K" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0090 ; owl:annotatedTarget "complementation" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0839 ; owl:annotatedTarget "Per mole per second, unit for association rate constant." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0839 ; owl:annotatedTarget "M-1s-1" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0840 ; owl:annotatedTarget "Molecule stimulating an interaction by interacting with one or more of the participants." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0841 ; owl:annotatedTarget "Measures the rate of a phosphate transfer between two molecules." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0841 ; owl:annotatedTarget "phosphotransferase" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0842 ; owl:annotatedTarget "Any molecule that is able to transfer a phosphate group to another chemical species." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0843 ; owl:annotatedTarget "Molecule to which a phosphate group may be transferred from a phosphate donor." . [] oboInOwl:hasDbXref "PMID:14755292", "PMID:16712436" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0844 ; owl:annotatedTarget "Reaction where a phosphate is transferred between two proteins of a phosphorelay system." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0844 ; owl:annotatedTarget "phosphotransfer" . [] oboInOwl:hasDbXref "PMID:10966640" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0845 ; owl:annotatedTarget "Paramagnetic fragment, most often a cyclic nitroxide derivative, covalently attached to a molecule of interest." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0091 ; owl:annotatedTarget "Used to separate and/or analyse complex mixtures. The components to be separated are distributed between two phases: a stationary phase (bed) and a mobile phase which percolates through the stationary bed. The nature of the two phases determines the separation criteria exploited by the column such as affinity, ionic charges, size or hydrophobicity of the molecules under analysis. Each type of column can be implemented with the mobile phase under atmospheric or high pressure condition. In this later case columns are designated as High Pressure Liquid Chromatography (HPLC)." . [] oboInOwl:hasDbXref "PMID:10966640" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0846 ; owl:annotatedTarget """Paramagnetic molecule (1-oxyl-2,2,5,5-tetramethylpyrroline- 3-methyl)-methanethiosulfonate. that can be covalently attached to any cysteine aminoacid producing a nitroxide side chain designated R1.""" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0847 ; owl:annotatedTarget "Dansyl is the acronym of 5-dimethylaminonaphthalene-1-sulfonyl radical group reacting with any NH2 groups." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0847 ; owl:annotatedTarget "5-dimethylaminonaphthalene-1-sulfonyl tag" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0847 ; owl:annotatedTarget "dansyl tag" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0848 ; owl:annotatedTarget "Molecule labelled with 125 radio isotope of iodine atoms." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0848 ; owl:annotatedTarget "125I" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0848 ; owl:annotatedTarget "I125" . [] oboInOwl:hasDbXref "PMID:10592169" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0849 ; owl:annotatedTarget """The NCBI taxonomy database indexes over 55 000 organisms that are represented in the sequence databases with at least one nucleotide or protein sequence. The Taxonomy Browser can be used to view the taxonomic position or retrieve sequence and structural data for a particular organism or group of organisms. Searches of the NCBI taxonomy may be made on the basis of whole or partial organism names, and direct links to organisms commonly used in biological research are also provided. The Taxonomy Browser can also be used to display the number of nucleic acid sequences, protein sequences, and protein structures available for organisms included in the branch. From the data display for a particular organism, one can retrieve and download the sequence data for that organism, or protein 3D structure data if available. http://www.ncbi.nlm.nih.gov/Taxonomy/""" . [] a owl:Axiom ; rdfs:label "[0-9]+" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_0849 ; owl:annotatedTarget "id-validation-regexp:" . [] a owl:Axiom ; rdfs:label "http://www.ncbi.nlm.nih.gov/Taxonomy/Browser/wwwtax.cgi?mode=Info&id=${ac}&lvl=3&lin=f&keep=1&srchmode=1&unlock" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_0849 ; owl:annotatedTarget "search-url:" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0091 ; owl:annotatedTarget "chromatography" . [] oboInOwl:hasDbXref "PMID:17372197" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0850 ; owl:annotatedTarget """ENCODE (the Encyclopedia Of DNA Elements) seeks to identify all protein-coding genes. The current ENCODE data set is derived from 1% of the human genome and has been selected for analysis in the pilot phase of the project. http://www.genome.gov/10005107""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0850 ; owl:annotatedTarget "ENCODE" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0850 ; owl:annotatedTarget "Encyclopedia Of DNA Elements" . [] oboInOwl:hasDbXref "PMID:17170002" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0851 ; owl:annotatedTarget "GenBank Identifier or GI numbers for proteins." . [] a owl:Axiom ; rdfs:label "[0-9]+" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_0851 ; owl:annotatedTarget "id-validation-regexp:" . [] a owl:Axiom ; rdfs:label "http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=protein&cmd=Retrieve&dopt=Graphics&list_uids=${ac}" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_0851 ; owl:annotatedTarget "search-url:" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0851 ; owl:annotatedTarget "GenBank Protein GI" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0851 ; owl:annotatedTarget "genbank protein gi" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0851 ; owl:annotatedTarget "genbank_protein_gi" . [] oboInOwl:hasDbXref "PMID:17170002" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0852 ; owl:annotatedTarget "GenBank Identifier or GI numbers for nucleotide." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0091 ; owl:annotatedTarget "column chromatography" . [] a owl:Axiom ; rdfs:label "[0-9]+" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_0852 ; owl:annotatedTarget "id-validation-regexp:" . [] a owl:Axiom ; rdfs:label "http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=nucleotide&cmd=Retrieve&dopt=Graphics&list_uids=$" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_0852 ; owl:annotatedTarget "search-url:" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0852 ; owl:annotatedTarget "GenBank Nucleotide" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0852 ; owl:annotatedTarget "genbank nucleotide" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0852 ; owl:annotatedTarget "genbank_nucl_gi" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0853 ; owl:annotatedTarget "An overhang is a stretch of unpaired nucleotides in the end of a DNA molecule. These unpaired nucleotides can be in either strand, creating either 3' or 5' overhangs. Longer overhangs are called cohessive ends or sticky ends. They are most often created by restriction endonucleases when they cut DNA. Very often they cut the two DNA strands four base pairs from each other, creating a four-base 3' overhang in the other molecule and a complementary 5' overhang in the other. These ends are called cohessive since they are easily joined back together by a ligase" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0853 ; owl:annotatedTarget "cohessive ends" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0853 ; owl:annotatedTarget "sticky ends" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0854 ; owl:annotatedTarget "An overhang is a stretch of unpaired nucleotides in the end of a 3' strand of a DNA molecule." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0854 ; owl:annotatedTarget "3 prime sticky end" . [] oboInOwl:hasDbXref "PMID:11470888" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0092 ; owl:annotatedTarget "Protein In Situ Array is a method by which protein arrays are rapidly generated in one step directly from DNA, by cell-free protein expression and simultaneous in situ immobilisation at a surface. Individual genes or fragments are produce by PCR or RT-PCR depending on the source of genetic material using properly designed primers. The PISA is generated by cell-free protein synthesis using coupled transcription and translation to produce a tagged protein, the reaction being carried out on a surface to which the protein adheres as soon as it is synthesised." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0855 ; owl:annotatedTarget "An overhang is a stretch of unpaired nucleotides in the end of a 5' strand of a DNA molecule." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0855 ; owl:annotatedTarget "5 prime sticky end" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0856 ; owl:annotatedTarget "A fluorophore is a component of a molecule which causes a molecule to be fluorescent. It is a functional group in a molecule which will absorb energy of a specific wavelength and re-emit energy at a different (but equally specific) wavelength. The amount and wavelength of the emitted energy depend on both the fluorophore and the chemical environment of the fluorophore." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0857 ; owl:annotatedTarget "Dye label containing a fluorophore which absorb energy of a specific wavelength and re-emit energy at a different (but equally specific) wavelength." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0857 ; owl:annotatedTarget "fluorescent dye" . [] oboInOwl:hasDbXref "PMID:17081976" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0858 ; owl:annotatedTarget "Method involving consecutive coimmunoimmunoprecipitations on the same sample, a control where an interaction is detected, and other CoIPs where the sample is previously treated with a specific antibody that precipitates a candidate interactor and leads to the suppression of an interaction or a change in composition of a complex." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0858 ; owl:annotatedTarget "immunodepleted coip" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0858 ; owl:annotatedTarget "immunodepletion" . [] oboInOwl:hasDbXref "PMID:18511917" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0859 ; owl:annotatedTarget "A single-molecule technique that measures the behavior of a molecular complex under stretching or torsional mechanical force." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0859 ; owl:annotatedTarget "intermolecular force" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0092 ; owl:annotatedTarget "PISA" . [] oboInOwl:hasDbXref "PMID:15078858" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0860 ; owl:annotatedTarget " edit" . [] a owl:Axiom ; rdfs:label "ENS[A-Z]+[0-9]{11}" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_0860 ; owl:annotatedTarget "id-validation-regexp:" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0861 ; owl:annotatedTarget "The protein A is a bacterial cell wall isolated from Staphylococcus aureus that binds to mammalian IgGs mainly through Fc regions. The protein A can be use to retaint antibodies or as fusion tag of a protein under analysis." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0861 ; owl:annotatedTarget "protein A" . [] oboInOwl:hasDbXref "PMID:11694505" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0862 ; owl:annotatedTarget "The ZZ tag is a tag made out of two tandem repeats of the Protein A IgG binding domain. " . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0862 ; owl:annotatedTarget "ZZ tag" . [] oboInOwl:hasDbXref "PMID:10077482" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0863 ; owl:annotatedTarget "Thiol-reactive lanthanide complexes have been synthesized that are luminescent when bound to terbium and/or europium. The Tb3+-DTPA-cs124-EMCH complexes consist of a diethylenetriaminepentaacetate (DTPA) chelate covalently joined through one amide bond to a chromophore, carbostyril 124, and via a second amide bond to a maleimide, bromoacetamide, or pyridyldithio moiety. This label can be Site-specific attached to both proteins and DNA." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0863 ; owl:annotatedTarget "Tb3+-DTPA-cs124-EMCH" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0863 ; owl:annotatedTarget "thiol lanthanide" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0864 ; owl:annotatedTarget """A structured controlled vocabulary for the source of an enzyme. It comprises terms for tissues, cell lines, cell types and cell cultures from uni- and multicellular organisms. http://www.brenda-enzymes.info""" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0092 ; owl:annotatedTarget "pisa" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0865 ; owl:annotatedTarget "Pair of fluorophores attached to the same molecule used in a fret experiment to observe the details of conformational changes." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0865 ; owl:annotatedTarget "fret pair" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0866 ; owl:annotatedTarget "Molecule whose sequence identity is not checked after the interaction but its presence is detected through its tag." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0867 ; owl:annotatedTarget "The molecule is produced fused to a tag containing a fluorophore, such as GFP tagged to a recombinant protein, or a fluorophore has been chemically attached to the molecule. Subsequence observation or measurement of fluorescence is used to identify the presence of the molecule in an interaction." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0867 ; owl:annotatedTarget "tag fluorescence" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0868 ; owl:annotatedTarget "Author published identifier." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0869 ; owl:annotatedTarget "Identifier assigned when the record was created by a source database." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0869 ; owl:annotatedTarget "original identifier" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0870 ; owl:annotatedTarget "Measures the catalysis of the hydrolysis of an methyl group from a substrate molecule." . [] oboInOwl:hasDbXref "GO:0006482", "PMID:17277772" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0871 ; owl:annotatedTarget "The cleavage of a methyl group from a polypeptide. Methylation is generally an irreversible reaction except in mamalian." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0093 ; owl:annotatedTarget "Single amino acid identification along a protein sequence." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0871 ; owl:annotatedTarget "demethylation" . [] oboInOwl:hasDbXref "PMID:17502105" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0872 ; owl:annotatedTarget """The atomic force microscope (AFM) is a very high-resolution type of scanning probe microscope, with demonstrated resolution of fractions of a nanometer, more than 1000 times better than the optical diffraction limit. The AFM was invented by Binnig, Quate and Gerber in 1986, and is one of the foremost tools for imaging, measuring and manipulating matter at the nanoscale.The term 'microscope' in the name is actually a misnomer because it implies looking, while in fact the information is gathered by feeling out the surface with a mechanical feeler. http://en.wikipedia.org/wiki/Atomic_force_microscope""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0872 ; owl:annotatedTarget "AFM" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0872 ; owl:annotatedTarget "atomic force microsc" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0873 ; owl:annotatedTarget "Annotation of a published paper which has been externally requested." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0875 ; owl:annotatedTarget "Targeted curation dataset grouping experiments by topic or dataset origin." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0878 ; owl:annotatedTarget "Data directly submitted by the authors to a database prior to publication." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0879 ; owl:annotatedTarget "Measures the catalysis of the hydrolysis of a nucleoside triphosphate into a nucleoside diphosphate plus phosphate." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0879 ; owl:annotatedTarget "triphosphatase ass" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0880 ; owl:annotatedTarget "Measures the catalysis of the hydrolysis of ATP+ H2O = ADP + phosphate." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0000 ; owl:annotatedTarget "mi" . [] oboInOwl:hasDbXref "PMID:12042868", "PMID:9237989" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0010 ; owl:annotatedTarget "Beta-galactosidase activity can be used to monitor the interaction of chimeric proteins. Pairs of inactive beta gal deletion mutants are capable of complementing to restore activity when fused to interacting protein partners. Critical to the success of this system is the choice of two poorly complementing mutant moieties, since strongly complementing mutants spontaneously assemble and produce functional beta-gal activity detectable in absence of any fused protein fragment." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0093 ; owl:annotatedTarget "protein sequence" . [] oboInOwl:hasDbXref "GO:0017111", "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0881 ; owl:annotatedTarget "Catalysis of the hydrolysis of a nucleoside triphosphate into a nucleoside diphosphate plus phosphate." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0881 ; owl:annotatedTarget "triphosphatase react" . [] oboInOwl:hasDbXref "GO:0016887", "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0882 ; owl:annotatedTarget "Catalysis of the hydrolisis of ATP+ H2O = ADP + phosphate." . [] oboInOwl:hasDbXref "GO:0003924", "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0883 ; owl:annotatedTarget "Catalysis of the hydrolisis of GTP+ H2O = GDP + phosphate." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0884 ; owl:annotatedTarget "Epitope tag derived from vesicular stomatitis virus (VSV) glycoprotein. The tag sequence is YTDIEMNRLGK and many antibodies against it are commercially available." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0884 ; owl:annotatedTarget "vesicular stomatitis virus tag" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0885 ; owl:annotatedTarget "Name and details of a journal from which paper has been taken." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0886 ; owl:annotatedTarget "Year of publication of a paper." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0887 ; owl:annotatedTarget "In histone acetylation the histones are acetylated on lysine residues in the N-terminal tail as part of gene regulation. Typically, these reactions are catalyzed by enzymes with \"histone acetyltransferase\" (HAt)" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0887 ; owl:annotatedTarget "HAt" . [] oboInOwl:hasDbXref "PMID:12015990" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0094 ; owl:annotatedTarget "A wide range of dyes have been used over the years to visualise proteins in polyacrylamide gels - Coomasie Blue and silver-staining being two classical methods. Fluorescent dyes such as Nile Red and SYPRO Orange are now increasingly used due to their superior dynamic range. Use of non-denaturing gels can allow visualisation of protein protein interactions. Several dyes can be used to specifically indicate residue modification, however this methodology will give no information as the number of residues modified or their position within the protein sequence. Examples include the use of acid fuscian or the fluorescent dansyl hydrazine to show protein glycosylation." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0887 ; owl:annotatedTarget "hat" . [] oboInOwl:hasDbXref "PMID:11578931" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0888 ; owl:annotatedTarget "During a SANS experiment a beam of neutrons is directed at a sample. The neutrons are elastically scattered by a sample and the resulting scattering pattern is analyzed to provide information about the size, shape and orientation of some component of the sample." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0888 ; owl:annotatedTarget "SANS" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0888 ; owl:annotatedTarget "sans" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0889 ; owl:annotatedTarget "Measures the catalysis of the addition of an acetyl group to a target molecule." . [] oboInOwl:hasDbXref "PMID:17569782" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0890 ; owl:annotatedTarget "Qdot are nanocrystals fluorophores . Nanocrystals a are extremely efficient materials for generating and they have a highly customizable surface for directing their bioactivity, producing a fluorescent probe that outperforms traditional dyes in many fluorescence applications." . [] oboInOwl:hasDbXref "PMID:10771422", "PMID:15272083", "PMID:15546977", "PMID:15914673", "PMID:16041074", "PMID:16707576" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0891 ; owl:annotatedTarget "Analysis of diffraction pattern of a partially ordered sample composed of fibers oriented parallel to each other using neutron beam." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0891 ; owl:annotatedTarget "neutron fiber diff" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0892 ; owl:annotatedTarget "Assay where at least one molecule under analysis is bound to a solid surface, such as a microplate wall or the sides of a tube, the other reactants being free in solution." . [] oboInOwl:hasDbXref "PMID:10771422", "PMID:15272083", "PMID:15546977", "PMID:15914673", "PMID:16041074", "PMID:16707576" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0893 ; owl:annotatedTarget "Analysis of diffraction pattern using neutron beam" . [] oboInOwl:hasDbXref "PMID:11827829" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0095 ; owl:annotatedTarget "ProteinChip(r) Array technology is a surface-enhanced laser desorption/ionization (SELDI) approach (Ciphergen Biosystems Inc. Fremont, CA, USA) for sample fractionation accomplished by retentate chromatography. Retentate chromatography is performed on ProteinChip Arrays with varying chromatographic properties (e.g. anion exchange, cation exchange, metal affinity and reverse phase). By utilising arrays with differing surface chemistries in parallel and in series, a complex mixture of proteins, as from cells or body fluids, can be resolved into subsets of proteins with common properties. Specific analytes can also be examined by using preactivated arrays to which a bait molecule (such as an antibody or biotinylated DNA) is immobilized and a solution containing the binding partner(s) is presented to the array. This array-based immunoprecipitation or protein-binding experiment has been used with good success to study DNA-binding proteins, receptor-ligand interactions, and protein complexes. Any ligand retained on a SELDI chip can directly be identified by mass spectrometry." . [] oboInOwl:hasDbXref "PMID:10949309", "PMID:11034202", "PMID:11171962", "PMID:11532455", "PMID:11700061", "PMID:15141214", "PMID:16325200" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0894 ; owl:annotatedTarget "Analysis of diffraction pattern using electron beam." . [] oboInOwl:hasDbXref "PMID:17942691" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0895 ; owl:annotatedTarget "This method uses Renilla luciferase (Rluc)-based protein fragment complementation assay (PCA) that is designed specifically to investigate dynamic protein complexes (association and dissociation). It is chose to generate a PCA based on the Rluc, which is, because of its simplicity and sensitivity, a widely used bioluminescence reporter. The general scheme for construction and detection of the Rluc-PCA PKA sensor consists of fusing complementary fragments of Rluc to the regulatory (Reg) and catalytic (Cat) PKA subunits of PKA." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0895 ; owl:annotatedTarget "pka complementation" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0896 ; owl:annotatedTarget "Renilla luciferase, is an enzyme of the sea pansy catalyzing the oxidation of the coelenterazine pigment) that produces light. Renilla luciferase produces a blue light of 480nm." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0896 ; owl:annotatedTarget "renilla luciferase" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0897 ; owl:annotatedTarget "Catalogue of covalent modification of, or a change resulting in an alteration of the measured molecular mass of, a peptide or protein amino acid residue." . [] a owl:Axiom ; rdfs:label "MOD:[0-9]{5}" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_0897 ; owl:annotatedTarget "id-validation-regexp:" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0897 ; owl:annotatedTarget "psi-mod" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0898 ; owl:annotatedTarget "Molecule that is reported to self-interact but the experimental condition does not allow to resolve whether the interaction is intramolecular (true self interaction) or intermolecular (homodimer)." . [] oboInOwl:hasDbXref "PMID:1696028" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0899 ; owl:annotatedTarget "pIII is one of the minor coat proteins that decorates in five copies the emerging tip of filamentous phage. Similarly to pVIII pIII also tolerates peptide insertions at the amino-terminus. The sequences to be displayed can either be encoded in the phage copy of the coat gene or in an extra pIII gene copy carried on a phagemid. In the first case 5 copies o the hybrid proteins are displayed while in the latter only a few capsid display one copy and the majority display none. Because of the low copy number pIII display is often referred to as low valency display." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0095 ; owl:annotatedTarget "SELDI ProteinChip" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0899 ; owl:annotatedTarget "low valency display" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0899 ; owl:annotatedTarget "p3 filamentous phage" . [] oboInOwl:hasDbXref "PMID:1720463" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0900 ; owl:annotatedTarget "pVIII is the major coat protein of filamentous phage. Its amino-terminus is exposed to solvent and tolerates the insertion of relatively large peptide fragments. By inserting the peptide coding sequence into the phage copy of the pVIII gene up to 3000 copies of the hybrid proteins can be displayed along the phage capsid. Alternatively the hybrid protein can be encoded on a phagemid that is incorporated in a virus like particle by infection with a helper phage. In this latter case one obtains a chimeric capsid where hybrid proteins are interspersed at different density in an otherwise wild type coat. Because of the high copy number pVIII display is also referred to as high valency display." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0900 ; owl:annotatedTarget "high valency display" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0900 ; owl:annotatedTarget "p8 filamentous phage" . [] oboInOwl:hasDbXref "PMID:18184591" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0901 ; owl:annotatedTarget "Exposed amino acid residues undergo a rapid exchange of a specific radio-isotope e.g. hydrogen/deuterium. Residues involved in a molecular interaction are protected from this exchange and exhibit a much slower rate of exchange. This method of binding range identification must be coupled to NMR or mass spectrometry technologies in order to detect the radio-isotope exchange." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0901 ; owl:annotatedTarget "isotope footprinting" . [] oboInOwl:hasDbXref "GO:0006396", "PMID:14681407" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0902 ; owl:annotatedTarget "Any process by which an RNA molecule is cleaved at specific sites or in a regulated manner." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0903 ; owl:annotatedTarget "The microbial protein-protein interactions database (MPDIB) aims to collect and provide all known physical prokaryotic interactions. Note as of 2013, this database is no longer active, but all IMEx curation was imported and is now maintained by the IntAct database (www.ebi.ac.uk/intact)." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0903 ; owl:annotatedTarget "MPDIB" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0095 ; owl:annotatedTarget "seldi chip" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0904 ; owl:annotatedTarget "A polysaccharide is a complex polymer of carbohydrate monormers. They are polymers made up of many monosaccharides joined together by glycosidic bonds. They are therefore very large, often branched, macromolecules." . [] oboInOwl:hasDbXref "PMID:17092917" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0905 ; owl:annotatedTarget "AlphaScreen relies on the use of Donor and Acceptor beads that are coated with a layer of hydrogel providing functional groups for bioconjugation. When a biological interaction between molecules brings the beads into proximity, a cascade of chemical reactions is initiated to produce a greatly amplified signal. Upon laser excitation, a photosensitizer in the Donor bead converts ambient oxygen to a more excited singlet state. The singlet state oxygen molecules diffuse across to react with a chemiluminescer in the Acceptor bead that further activates fluorophores contained within the same bead. The fluorophores subsequently emit light at 520-620 nm. In the absence of a specific biological interaction, the singlet state oxygen molecules produced by the Donor bead go undetected without the close proximity of the Acceptor bead. AlphaScreen has successfully been developed for enzyme assays (kinase, helicase, protease, ...), interaction assays (ligand/receptor, protein/protein, protein/DNA), immunoassays, and GPCR functional assays (cAMP, IP3)." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0905 ; owl:annotatedTarget "AlphaScreen" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0905 ; owl:annotatedTarget "alpha-screen" . [] oboInOwl:hasDbXref "PMID:18216269" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0906 ; owl:annotatedTarget "The protein of interest is expressed as a fusion to the peptide DTYRYI for which antibodies are commercially available." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0906 ; owl:annotatedTarget "DTYRYI epitope tag" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0907 ; owl:annotatedTarget "Statement about the native/denatured conformation of the protein." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0096 ; owl:annotatedTarget "A specific affinity chromatography method where a molecule of interest (bait) is bound to a column, often via an affinity tag expressed as a protein fusion (GST, HIS tag and others) or chemically linked to the bait molecule . The molecule may be expressed or synthesised and purified first, often in an heterologous system, bound to the matrix at high concentration and then challenged with a solution or cellular extract containing the candidate partner molecules. Alternatively, a multi-molecular complex may be adsorbed to the resin and the retained binding molecules subsequently identified." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0907 ; owl:annotatedTarget "conformation" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0908 ; owl:annotatedTarget "Altered conformation state of the protein as a result of heat or chemical modification resulting in a changed structure of the protein." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0909 ; owl:annotatedTarget "State of the protein without interference i.e. the natural form." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0910 ; owl:annotatedTarget "Covalent bond breakage of a nucleic acid molecule leading to the formation of smaller fragments." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0910 ; owl:annotatedTarget "ncl acid cleavage" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0911 ; owl:annotatedTarget "A variety of crosslinkers are used to analyze subunit structure of proteins, protein interactions and various parameters of protein function. Subunit structure is deduced since crosslinkers only bind surface amino residues in relatively close proximity in the native state. Protein interactions are often too weak or transient to be easily detected, but by crosslinking, the interactions can be captured and analyzed." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0911 ; owl:annotatedTarget "crosslinker" . [] oboInOwl:hasDbXref "PMID:17360572" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0912 ; owl:annotatedTarget """N -Succinimidyl 3-(2-pyridyldithio)-propionate, is heterobifunctional, thiol-cleavable and membrane permeable crosslinkers. It contains an amine-reactive N-hydroxysuccinimide (NHS) ester that will react with lysine residues to form a stable amide bond. The other end of the spacer arm is terminated in the pyridyl disulfide group that will react with sulfhydryls to form a reversible disulfide bond.""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0912 ; owl:annotatedTarget "N -Succinimidyl 3-(2-pyridyldithio)-propionate" . [] oboInOwl:hasDbXref "PMID:17360572" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0913 ; owl:annotatedTarget """Succinimidyl 6-(3-[2-pyridyldithio]-propionamido)hexanoate, is an heterobifunctional, thiol-cleavable and membrane permeable crosslinkers. It contains an amine-reactive N-hydroxysuccinimide (NHS) ester that will react with lysine residues to form a stable amide bond. The other end of the spacer arm is terminated in the pyridyl disulfide group that will react with sulfhydryls to form a reversible disulfide bond. LC-SPDP is a derivative of the classical SPDP with a longer spacer arm.""" . [] oboInOwl:hasDbXref "PMID:11160938" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0097 ; owl:annotatedTarget "In this complementation approach the bait can be any membrane protein (for example a receptor or a channel protein), the prey is cloned as a fusion protein of any cDNA from a library and the coding sequence of cytoplasmic RAS (cdc25 in yeast). If the bait and the prey interact, RAS is recruited close to the membrane and can activate cell growth. This procedure must take place in cells having a mutated RAS (Cdc25-2 yeast strain having a temperature sensitive mutation of RAS) to avoid constitutive growth activation." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0913 ; owl:annotatedTarget "Succinimidyl 6-(3-[2-pyridyldithio]-propionamido)hexanoate" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0914 ; owl:annotatedTarget "Interaction between molecules that may participate in formation of one, but possibly more, physical complexes. Often describes a set of molecules that are co-purified in a single pull-down or coimmunoprecipitation but might participate in formation of distinct physical complexes sharing a common bait." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0915 ; owl:annotatedTarget "Interaction between molecules within the same physical complex. Often identified under conditions which suggest that the molecules are in close proximity but not necessarily in direct contact with each other." . [] oboInOwl:hasDbXref "PMID:9371806" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0916 ; owl:annotatedTarget "Yeast two-hybrid system using Escherichia coli LexA amino acids 1-202 as the DNA-binding domain (BD), and a transcriptional activation domain from the herpes simplex virus protein VP16 (either aa 411-490 or aa 411-455) that can specifically activate transcription of a reporter gene located downstream." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0916 ; owl:annotatedTarget "LexA VP16 transcription complementation" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0916 ; owl:annotatedTarget "lexa vp16 complement" . [] oboInOwl:hasDbXref "PMID:19147664" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0917 ; owl:annotatedTarget "Knowledgebase of the extracellular matrix storing experimentally determined interactions involving extracellular biomolecules. It includes protein-protein, protein-polysaccharide, and protein-lipid interactions." . [] a owl:Axiom ; rdfs:label "http://matrixdb.univ-lyon1.fr/cgi-bin/current/newPort?type=biomolecule&value=${ac}" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_0917 ; owl:annotatedTarget "search-url:" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0917 ; owl:annotatedTarget "MatrixDB" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0918 ; owl:annotatedTarget "Molecule which emits active chemical groups, electrons or ions that are transfered to an acceptor molecule." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0097 ; owl:annotatedTarget "reverse RRS" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0919 ; owl:annotatedTarget "Molecule able to receive active chemical groups, electrons or ions from a donor molecule." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0920 ; owl:annotatedTarget "Measures the catalysis of the hydrolysis of phosphodiester bonds in chains of RNA." . [] oboInOwl:hasDbXref "PMID:16510109", "PMID:16837183", "PMID:17889820" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0921 ; owl:annotatedTarget "This array technology allows the screening of binding abilities of hundreds or thousands of biomolecules (small molecule, peptide, protein, sugar, lipid, nucleic acid, and their fragments) printed onto the gold-coated chip by using an instrument (micro-arrayer) that is capable of spotting liquid samples in a reproducible manner onto a planar support. The ordered protein array can then be probed with a non-labelled sample (small molecule, peptide, protein, sugar, lipid, nucleic acid, and their fragments) to identify the baits that can bind to it. This is done in real time, allowing direct measurement of both the on-rate and the off-rate and of the affinity constant of complex formation on each spot." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0921 ; owl:annotatedTarget "Biacore Flexchip(r)" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0921 ; owl:annotatedTarget "SPRImager" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0921 ; owl:annotatedTarget "SPRi-Plex " . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0921 ; owl:annotatedTarget "spr array" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0922 ; owl:annotatedTarget "Experimental evidence supporting an interaction curated and released under the IMEx agreement." . [] oboInOwl:hasDbXref "PMID:18823568" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0923 ; owl:annotatedTarget """iRefIndex provides an index of protein interactions available in a number of primary interaction databases including BIND, BioGRID, DIP, HPRD, IntAct, MINT, MPact, MPPI and OPHID. This index allows the user to search for a protein and retrieve a non-redundant list of interactors for that protein. iRefIndex uses the Sequence Global Unique Identifier (SEGUID) to group proteins and interactions into redundant groups. This method allows users to integrate their own data with the iRefIndex in a way that ensures proteins with the exact same sequence will be represented only once. http://irefindex.uio.no/""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0923 ; owl:annotatedTarget "iRefIndex" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0097 ; owl:annotatedTarget "reverse rrs" . [] oboInOwl:hasDbXref "PMID:106882042" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0924 ; owl:annotatedTarget """Camjedb is a comprehensive database for information on the genome of Campylobacter jejuni. http://www.sanger.ac.uk/Projects/C_jejuni/""" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0925 ; owl:annotatedTarget "Post translational modification observed on a protein in the context of an interaction." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0925 ; owl:annotatedTarget "observed ptm" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0925 ; owl:annotatedTarget "observed-ptm" . [] oboInOwl:hasDbXref "PMID:9657724" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0926 ; owl:annotatedTarget "This fluorescent label is a small ligand membrane-permeant and nonfluorescent until it binds with high affinity and specificity to the tetracysteine domain. Such in situ labeling adds much less mass than does green fluorescent protein and offers greater versatility in attachment sites as well as potential spectroscopic and chemical properties." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0926 ; owl:annotatedTarget "4',5'-bis(1,3,2-dithioarsolan-2-yl)fluorescein " . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0926 ; owl:annotatedTarget "FIAsH label" . [] oboInOwl:hasDbXref "PMID:11052891" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0927 ; owl:annotatedTarget "IAEDANS is fluorescent tag that bind to cysteines. IAEDANS is the acronyme of (5((((2-iodoacetyl)amino)ethyl)amino)-naphthalene-1-sulfonic acid) with free SH groups." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0927 ; owl:annotatedTarget "(5((((2-iodoacetyl)amino)ethyl)amino)-naphthalene-1-sulfonic acid) " . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0927 ; owl:annotatedTarget "1,5-IAEDANS" . [] oboInOwl:hasDbXref "PMID:11551470", "PMID:12167034" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0098 ; owl:annotatedTarget "This method permits the coupling of phenotype to genotype via the formation of a non-covalent ternary complex between mRNAs and their encoded polypeptides while they are translated in an in vitro system. As a first step a cDNA library is constructed that encodes chimeric proteins in which the natural proteins or protein domains are fused to a C-terminal tether. As a consequence when the mRNA is translated in vitro the domain can fold while the tether is still in the ribosomal tunnel. Furthermore this chimeric mRNAs lack a stop codon, thus preventing release of the mRNA and the polypeptide from the ribosome. High concentrations of magnesium and low temperature further stabilise the ternary complex. Similarly to phage display, these complexes can be used directly to select for nucleic acids encoding proteins with desired properties." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0927 ; owl:annotatedTarget "IAEDANS" . [] oboInOwl:hasDbXref "PMID:10859365" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0928 ; owl:annotatedTarget "Biomolecules are mixed in a buffer and the resulting mixture is passed through a filter. Large aggregates are retained on the filter and the pariticipants may then be identified." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0928 ; owl:annotatedTarget "Filter retention assay" . [] oboInOwl:hasDbXref "PMID:414220" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0929 ; owl:annotatedTarget """A standard procedure to identify RNA fragments containing specific sequences. In this procedure RNA fragments are separated by electrophoresis, the fragments are transferred to a membrane and the membrane is incubated with a radio labelled probe that hybridises any complementary subsequence.""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0929 ; owl:annotatedTarget "northen" . [] oboInOwl:hasDbXref "PMID:11988766" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0930 ; owl:annotatedTarget """An effect in which individual perturbations of two different genes result in different mutant phenotypes, and the resulting phenotype of their combination (the double mutant) is equal to that of only one of the perturbations. With respect to any single quantifiable phenotype, this may be expressed as an inequality as: (a != wt AND b != wt AND a != b) AND (ab = a OR ab = b) where 'a' and 'b' are the observed phenotype values of the individual perturbations, 'ab' is the observed phenotype value of the double perturbation, 'wt' is the wild type phenotype value and 'a != b' indicates qualitatively or quantitatively different phenotypes.""" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0931 ; owl:annotatedTarget "Two genes A and B present an genetic interaction defined by inequality if the phenotypes of the two single mutants a and b, the double mutant ab and the wild-type WT can be measured quantitatively and described relative to each other by an inequality relationship." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0931 ; owl:annotatedTarget "genetic inequality" . [] oboInOwl:hasDbXref "PMID:15833125" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0932 ; owl:annotatedTarget "The observation that, when tested, no interaction was observed between two or more genes, for a given phenotype. In other words, the phenotype of the combined perturbations a and b result in the expected phenotype." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0932 ; owl:annotatedTarget "noninteractive genetic interaction (sensu inequality)" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0010 ; owl:annotatedTarget "beta galactosidase" . [] oboInOwl:hasDbXref "PMID:3866247" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0099 ; owl:annotatedTarget "SPA relies upon the fact that a beta particle emitted from a radioisotope decay can excite a fluorophore only when it is at a very short distance in water solution (few micrometers). The ligand is labelled with a radioactive atom and its potential partner is fixed to fluorophore containing beads, the emitted fluorescence proving their interaction can be measured in a scintillation counter. The scintillator measures only the amount of bound radiolabelled ligand. Competition experiment with cold competitor can be done to estimate the binding affinities (50% inhibitory concentration [IC50], cold ligand versus labelled ligand). Loss of signal can also be used to measure substrate cleavage by an enzyme, and labelled antibodies used to titrate the degree of modified residue present." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0933 ; owl:annotatedTarget """An effect in which two genetic perturbations, when combined, result in a phenotype that is more severe/penetrant than expected given the phenotypes of the individual perturbations. With respect to any single quantifiable phenotype, this may be expressed as an inequality as: ab < E <= wt OR wt <= E < ab where 'ab' is the observed phenotype value of the double perturbation, 'E' is the expected phenotype value of the double perturbation, and 'wt' is the wild type phenotype value.""" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0934 ; owl:annotatedTarget """OBSOLETE: An effect in which the observed phenotype of individual perturbations and/or the double perturbation collectively exhibit values both greater than AND less than wild type (on the same scale). Alternatively, this could describe a scenario in which individual perturbations result in qualitatively different phenotypes. With respect to any single quantifiable phenotype, this may be expressed as an inequality as: a < wt < b [ab != E] OR With respect to two qualitatively different phenotypes, this may be expressed as an inequality as: (a != wt AND b != wt AND a != b) where 'a' and 'b' are the observed phenotype values of the individual perturbations, 'ab' is the observed phenotype value of the double perturbation, 'E' is the expected phenotype value of the double perturbation, 'wt' is the wild type phenotype value and 'a != b' indicates qualitatively different phenotypes.""" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0934 ; owl:annotatedTarget "neutral gent int" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0935 ; owl:annotatedTarget """An effect in which two genetic perturbations, when combined, result in a phenotype that is less severe/penetrant than would be expected from the original phenotypes, in effect making the organism more \"wild type\" in character with regards to the phenotype in question. With respect to any single quantifiable phenotype, this may be expressed as an inequality as: E < ab <= wt OR wt <= ab < E where 'ab' is the observed phenotype value of the double perturbation, 'E' is the expected phenotype value of the double perturbation, and 'wt' is the wild type phenotype value.""" . [] oboInOwl:hasDbXref "PMID:14643225" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0936 ; owl:annotatedTarget """The Electron Microscopy Data Bank (EMDB) contains experimentally determined three-dimensional maps and associated experimental data and files. https://www.ebi.ac.uk/emdb""" . [] a owl:Axiom ; rdfs:label "https://www.ebi.ac.uk/emdb/${ac}" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_0936 ; owl:annotatedTarget "search-url:" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0936 ; owl:annotatedTarget "Electron Microscopy Data Bank" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0936 ; owl:annotatedTarget "eMDB" . [] oboInOwl:hasDbXref "PMID:8077219" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0937 ; owl:annotatedTarget "This peptide is a 314 to 319 amino acids fragment of the middle T antigen of mouse polymavirus. Glu-Glu epitope peptide." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0937 ; owl:annotatedTarget "glu tag" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0099 ; owl:annotatedTarget "RIA Radio Immuno Assay" . [] oboInOwl:hasDbXref "PMID:18445655" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0938 ; owl:annotatedTarget "Characterization of viscoelastic properties of biomolecule solution is used to infer interactions between molecules." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0938 ; owl:annotatedTarget "rheology" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0939 ; owl:annotatedTarget "Fluorescence label used to monitor the presence of a protein." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0939 ; owl:annotatedTarget "fluorescein" . [] oboInOwl:hasDbXref "PMID:18066077" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0940 ; owl:annotatedTarget "Fluorescein-5-maleimide is one of the most popular fluorescent dyes for thiol modifications of proteins at cysteine residues that either are intrinsically present or result from reduction of cystines. Unlike iodoacetamides, maleimides do not react with histidines and methionines under physiological conditions." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0940 ; owl:annotatedTarget "fluor-5-maleimide" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0941 ; owl:annotatedTarget "Binds to an interacting molecule in competition with other interaction candidates, for example at a shared binding site." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0941 ; owl:annotatedTarget "competitor" . [] oboInOwl:hasDbXref "PMID:18836194" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0942 ; owl:annotatedTarget """Based on NCBO Taxonomy but adapted for UniProt http://www.uniprot.org/taxonomy/""" . [] a owl:Axiom ; rdfs:label "[0-9]+" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_0942 ; owl:annotatedTarget "id-validation-regexp:" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0099 ; owl:annotatedTarget "SPA" . [] a owl:Axiom ; rdfs:label "http://www.uniprot.org/taxonomy/${ac}" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_0942 ; owl:annotatedTarget "search-url:" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0942 ; owl:annotatedTarget "uniprot taxon" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0943 ; owl:annotatedTarget "'Study of interactions by an analytical technique based on measurements of mass-to-charge ratio of charged particles in a mass spectrometer." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0943 ; owl:annotatedTarget "ms interact detect" . [] oboInOwl:hasDbXref "PMID:18948593" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0944 ; owl:annotatedTarget "Mass spectroscopy based measurement of the rate and/or extent of the hydrogen/deuterium exchange." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0944 ; owl:annotatedTarget "h1-h2 ms" . [] oboInOwl:hasDbXref "GO:GO:0016491", "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0945 ; owl:annotatedTarget "An oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0945 ; owl:annotatedTarget "redox reaction" . [] oboInOwl:hasDbXref "PMID:19098921" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0946 ; owl:annotatedTarget "Combines on-chip in-vitro protein synthesis with an in situ microfluidic affinity assay. Co-spotted DNA microarray containing a linear template encoding the proteins is aligned and bonded with a microfluidic device that creates chambers in the array chip. The experiment consists of three main stages: (i) an antibody that recognizes the bait protein or a specific tag is deposited on a circular area inside each individual chamber; (ii) proteins are expressed in vitro by transcription and translation of DNA spotted on the chip; (iii) the bait is immobilized on the chamber surface by the antibody and the chamber is washed, retaining only interacting bait-prey pairs." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0946 ; owl:annotatedTarget "MITOMI" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0099 ; owl:annotatedTarget "spa" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0946 ; owl:annotatedTarget "mIP" . [] oboInOwl:hasDbXref "PMID:19114658" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0947 ; owl:annotatedTarget "Binding of proteins bound to beads leads to a measurable aggregation of the beads." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0947 ; owl:annotatedTarget "bead aggregation" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0948 ; owl:annotatedTarget "A brief description (such as temp, pH) of the conditions under which a kinetic measurment has been performed." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0948 ; owl:annotatedTarget "kinetic_conditions" . [] oboInOwl:hasDbXref "PMID:17925023" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0949 ; owl:annotatedTarget """Experiments monitoring interactions of GTP-GDP exchange factors with their cognate GTPases.""" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0949 ; owl:annotatedTarget "gdp_gtp exchange" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0949 ; owl:annotatedTarget "gtp/gdp exchange" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0949 ; owl:annotatedTarget "guanine nucleotide exchange assay" . [] oboInOwl:hasDbXref "PMID:9050838" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0950 ; owl:annotatedTarget "Permits the identification of substrates of enzymes by mutating residues, usually in the active site such that the enzyme will bind but not act on its substrate." . [] oboInOwl:hasDbXref "PMID:11707606" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0100 ; owl:annotatedTarget "Multiple alignments of orthologous sequences in the same species and their corresponding phylogenetic trees are built. Every phylogenetic tree is computed as a matrix of distances between all possible interacting pairs. The covariation of the distance matrices reveals interacting pairs." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0950 ; owl:annotatedTarget "trap-mutant" . [] oboInOwl:hasDbXref "PMID:17925023" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0951 ; owl:annotatedTarget "Reference to the master sequence from which this chain has been derived." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0951 ; owl:annotatedTarget "chain-parent" . [] oboInOwl:hasDbXref "PMID:17925023" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0952 ; owl:annotatedTarget "Deprecated IMEx identifiers should be exchanged in IMEx records and stored as cross reference with this qualifier." . [] oboInOwl:hasDbXref "PMID:19081060" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0953 ; owl:annotatedTarget "Interaction inferred by monitoring polymerization/depolymerization of an interactor" . [] oboInOwl:hasDbXref "PMID:17893861" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0954 ; owl:annotatedTarget "An assessment of the depth and extent to which a paper has been curated" . [] oboInOwl:hasDbXref "PMID:17893861" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0955 ; owl:annotatedTarget "Assessment of the depth to which a paper has been curated" . [] oboInOwl:hasDbXref "PMID:17893861" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0956 ; owl:annotatedTarget "Assessment to the extent of interactions captured in this paper" . [] oboInOwl:hasDbXref "PMID:17893861" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0957 ; owl:annotatedTarget "All interactions which can be ascribed to an unambiguous identified in this paper have been captured." . [] oboInOwl:hasDbXref "PMID:17893861" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0958 ; owl:annotatedTarget "Not all interactions which can be ascribed to an unambiguous identified in this paper have been captured." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0100 ; owl:annotatedTarget "sequence phylogeny" . [] oboInOwl:hasDbXref "PMID:17893861" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0959 ; owl:annotatedTarget "Paper has been curated to full IMEx specifications" . [] oboInOwl:hasDbXref "PMID:17687370" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0960 ; owl:annotatedTarget "Paper has been curated to meet MIMIx specifications" . [] oboInOwl:hasDbXref "PMID:17687370" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0961 ; owl:annotatedTarget "Minimal interaction data has been extracted from the paper" . [] oboInOwl:hasDbXref "PMID:17571060" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0962 ; owl:annotatedTarget "The protein of interest is expressed with a StrepII fusion peptide Ser-Ala-Trp-Ser-His-Pro-Gln-Phe-Glu-Lys (SAWSHPQFEK)." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0962 ; owl:annotatedTarget "Strep (II)" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0962 ; owl:annotatedTarget "Strep II" . [] oboInOwl:hasDbXref "PMID:14681455" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0963 ; owl:annotatedTarget "A specific pull down method where the protein of interest (bait) is endogenously expressed with at least two affinity tags (GFP, FLAG or others). The bait is purified in parallel using different purification protocols in contrast to tandem affinity purification (TAP) (publication currently in press)." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0963 ; owl:annotatedTarget "ipac" . [] oboInOwl:hasDbXref "PMID:15212548" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0964 ; owl:annotatedTarget "Subset of spectroscopy that deals with the infrared region of the electromagnetic spectrum." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0964 ; owl:annotatedTarget "ir spectrometry" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0101 ; owl:annotatedTarget "Computational methods based on evolutionary hypothesis, used as criteria to browse sequences and predict interacting pairs." . [] oboInOwl:hasDbXref "PMID:17502604" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0965 ; owl:annotatedTarget "Two-dimensional infrared correlation spectroscopy analysis is the application of 2D correlation analysis on infrared spectra. 2D IR spectroscopy probes molecular structures by means of vibrational frequencies, couplings, and transition dipole angles." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0965 ; owl:annotatedTarget "2d-ir" . [] oboInOwl:hasDbXref "PMID:18799738" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0966 ; owl:annotatedTarget "Ultraviolet-visible spectroscopy or ultraviolet-visible spectrophotometry (UV-Vis or UV/Vis) involves the spectroscopy of photons in the UV-visible region. This means it uses light in the visible and adjacent (near ultraviolet (UV) and near infrared (NIR)) ranges." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0966 ; owl:annotatedTarget "uv-vis" . [] oboInOwl:hasDbXref "PMID:19194660", "PMID:24214965" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0967 ; owl:annotatedTarget "ChEMBL focuses on mapping the interactions of small molecules binding to their macromolecular targets." . [] a owl:Axiom ; rdfs:label "[0-9]+" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_0967 ; owl:annotatedTarget "id-validation-regexp:" . [] a owl:Axiom ; rdfs:label "http://www.ebi.ac.uk/chembldb/index.php/compound/inspect/${ac}" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_0967 ; owl:annotatedTarget "search-url:" . [] oboInOwl:hasDbXref "PMID:10872504" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0968 ; owl:annotatedTarget "A biosensor is a device for the detection of an analyte that combines a biological component with a physicochemical detector component" . [] oboInOwl:hasDbXref "PMID:19561609" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0969 ; owl:annotatedTarget "BLI is an optical analytical technique that analyzes the interference pattern of white light reflected from two surfaces: a layer of immobilized protein on the biosensor tip, and an internal reference layer" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0969 ; owl:annotatedTarget "bli" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0101 ; owl:annotatedTarget "predict from sequenc" . [] oboInOwl:hasDbXref "PMID:15889163" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0970 ; owl:annotatedTarget "InChIKeys consist of 14 characters resulting from a hash of the connectivity information of the InChI, followed by a hyphen, followed by 9 characters resulting from a hash of the remaining layers of the InChI, followed by a single character indication the version of InChI used, another hyphen, followed by single checksum character" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0970 ; owl:annotatedTarget "inchi key" . [] oboInOwl:hasDbXref "PMID:19679086" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0971 ; owl:annotatedTarget "The posttranslational phosphopantetheinylation of peptidyl-serine to form peptidyl-O-phosphopantetheine-L-serine." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0971 ; owl:annotatedTarget "p_patetheinylation" . [] oboInOwl:hasDbXref "PMID:19346479" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0972 ; owl:annotatedTarget "Assay of the posttranslational phosphopantetheinylation of peptidyl-serine to form peptidyl-O-phosphopantetheine-L-serine." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0972 ; owl:annotatedTarget "p_pantethinyl assay" . [] oboInOwl:hasDbXref "PMID:17893861" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0973 ; owl:annotatedTarget "Databases that contain curated experimental interaction data and exchanging it with other IMEx databases." . [] oboInOwl:hasDbXref "PMID:18766178" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0974 ; owl:annotatedTarget "Human and mouse experimentally verified interactions and pathways involved in innate immunity." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0974 ; owl:annotatedTarget "InnateDB" . [] oboInOwl:hasDbXref "PMID:11757069" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0975 ; owl:annotatedTarget "A fusion protein tag consisting of a portion of the constant region of IgG." . [] oboInOwl:hasDbXref "PMID:10967324", "PMID:11752590", "PMID:11805837" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0102 ; owl:annotatedTarget "This approach leads to protein identification by combining mass measurement and short amino acid sequence information obtained by tandem mass spectrometry. This information is then used to automatically find the best match in a sequence database. A mixture of peptides derived from a protease digestion is analysed by nanoelectrospray LC-MS/MS (Liquid Chromatography Tandem Mass Spectrometer or nanoESI MS/MS) mass spectrometry. Electrospray mass spectrometry cannot be applied to dilute samples and is affected by high salt. As a consequence peptides, normally extracted from acrylamide gels by in situ proteolysis, are desalted and concentrated on a microcolumn followed by elution into a capillary used for nanoelectrospray tandem mass spectrometry. A first mass spectrum (Normal mass spectrum or Q1 mass spectrum) gives information about the masses of all the peptides. Peptides observed in the normal mass spectrum are isolated in turn and dissociated into fragments by collision with gas molecules within the mass spectrometer. Some of the fragments obtained from a peptide constitute a nested set, differing by one amino acid, and the mass difference between them allows assignment of a partial sequence. The masses of the fragments define the position of the partial sequence in the peptide. Together with the cleavage specificity of the protease used to cleave the protein, and mass information such sequence tag provides much higher search specificity to match the a database entry. The procedure is repeated with several peptides from the digest, resulting in multiple identifications of the same protein or identification of several proteins from the peptide mixture. Unknown proteins can easily be identified by using the high specificity of the peptide sequence tag for searches in most sequence databases including EST or genome databases." . [] oboInOwl:hasDbXref "PMID:9013655" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0976 ; owl:annotatedTarget "Used to study surface-associated interactions at the molecular level. In this method, the evanescent field from an internally reflected excitation source selectively excites fluorescent molecules on or near a surface." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0976 ; owl:annotatedTarget "tirfs" . [] oboInOwl:hasDbXref "PMID:17893861" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0977 ; owl:annotatedTarget "Prevents export of experiment and associated interactions to IMEx" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0978 ; owl:annotatedTarget "Author given name for a participant, not commonly found in source databases." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0979 ; owl:annotatedTarget "Catalysis of oxido-reductions. The substrate oxidized is regarded as the hydrogen or electron donor. The classification is based on 'donor:acceptor oxidoreductase'. The common name is 'dehydrogenase', wherever this is possible; as an alternative, 'acceptor reductase' can be used. 'Oxidase' is used only where O2 is an acceptor." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0979 ; owl:annotatedTarget "oxidoreduct assay" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0980 ; owl:annotatedTarget "The protein is expressed as a hybrid protein fused to a tag containing an enzyme activity e.g. peroxidase. Subsequence observation or measurement of enzyme activity is used to identify the presence of the molecule in an interaction." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0980 ; owl:annotatedTarget "tag enzyme assay" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0981 ; owl:annotatedTarget "The protein is expressed as a hybrid protein fused to a tag containing a peroxidase activity. Subsequent observation or measurement of peroxidase activity is used to identify the presence of the molecule in an interaction." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0981 ; owl:annotatedTarget "tag perox activity" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0102 ; owl:annotatedTarget "sequence tag" . [] oboInOwl:hasDbXref "PMID:19517512" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0982 ; owl:annotatedTarget "Any method which relies on the motion of particles relative to a matrix under the influence of an electrical field." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0982 ; owl:annotatedTarget "electrophoresis" . [] oboInOwl:hasDbXref "PMID:16861739" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0983 ; owl:annotatedTarget """GEMMA is a method to study protein complexes in solution: a diluted protein sample is transmitted into the gas phase by a charged reduced electrospray process. The generated particles, each containing one protein molecule with a +1 charge, are separated according to size in a differential mobility analyzer and subsequently quantified by a particle counter. In contrast to mass spectrometry, this method is run at atmospheric pressure and measures the diameter of the particle rather than the mass.""" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0984 ; owl:annotatedTarget "The measurement of the removal of an amine group from a molecule." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0984 ; owl:annotatedTarget "aminase assay" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0984 ; owl:annotatedTarget "deamination" . [] oboInOwl:hasDbXref "PMID:14760721" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0985 ; owl:annotatedTarget "The removal of an amine group from a molecule." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0985 ; owl:annotatedTarget "deamination" . [] oboInOwl:hasDbXref "PMID:159156" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0986 ; owl:annotatedTarget "The lengthening of a strand of a nucleic acid by the systematic addition of bases by a polymerase." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0986 ; owl:annotatedTarget "strand elongation" . [] oboInOwl:hasDbXref "PMID:12042868" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0011 ; owl:annotatedTarget "This strategy is based on a protein fragment complementation assay (PCA) of the enzyme TEM-1 beta-lactamase. The approach includes a simple colorimetric in vitro assays using the cephalosporin nitrocefin and assays in intact cells using the fluorescent substrate CCF2/AM. The combination of in vitro colorimetric and in vivo fluorescence assays of beta-lactamase in mammalian cells permits a variety of sensitive and high-throughput large-scale applications." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0103 ; owl:annotatedTarget "A standard procedure to identify DNA fragments containing specific gene sequences. In this procedure i) a genome is fragmented using a restriction enzyme ii) the generated fragments are separated by electrophoresis iii) the fragments are transferred to a membrane iv)the membrane is incubated with a radio labelled probe that hybridises any complementary subsequence." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0987 ; owl:annotatedTarget "The process by which an RNA strand is synthesized from template DNA by the action of polymerases, which add nucleotides to the 3' end of the nascent RNA strand." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0987 ; owl:annotatedTarget "rna elongation" . [] oboInOwl:hasDbXref "PMID:17571060" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0988 ; owl:annotatedTarget "Synthetic peptide consisting of 8 amino acids Trp-Ser-His-Pro-Gln-Phe-Glu-Lys (WSHPQFEK)." . [] oboInOwl:hasDbXref "PMID:14760721" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0989 ; owl:annotatedTarget "The measurement of the addition of an amine group to a molecule." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0989 ; owl:annotatedTarget "amidation" . [] oboInOwl:hasDbXref "PMID:14760721" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0990 ; owl:annotatedTarget "The cleavage of a biomolecule either into its component parts or sub-parts." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0990 ; owl:annotatedTarget "cleavage" . [] oboInOwl:hasDbXref "PMID:14760721" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0991 ; owl:annotatedTarget "The cleavage of a lipid molecule from a larger biomolecule." . [] oboInOwl:hasDbXref "PMID:14760721" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0992 ; owl:annotatedTarget "Measures the removal of S-farnesyl-L-cysteined, which is cleaved and returns a C residue." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0992 ; owl:annotatedTarget "defarnesylation assay" . [] oboInOwl:hasDbXref "PMID:9013660" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0104 ; owl:annotatedTarget "In static light scattering, the average intensity of scattered light at multiple angles is measured. The data yield information on particle molecular weight, particle size and shape, and particle-particle interactions." . [] oboInOwl:hasDbXref "PMID:14760721" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0993 ; owl:annotatedTarget "Measures the removal of S-geranylgeranyl-L-cysteine, which is cleaved and returns a C residue." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0993 ; owl:annotatedTarget "degeranylation assay" . [] oboInOwl:hasDbXref "PMID:14760721" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0994 ; owl:annotatedTarget "measures the removal of N6-myristoyl-L-lysine, which is cleaved and returns a K residue." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0994 ; owl:annotatedTarget "demyristoylation assay" . [] oboInOwl:hasDbXref "PMID:14760721" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0995 ; owl:annotatedTarget "Measures the removal of S-palmitoyl-L-cysteine, N6-palmitoyl-L-lysine, O-palmitoyl-L-threonine or O-palmitoyl-L-serine, which are cleaved and return C,K,T or S residues." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0995 ; owl:annotatedTarget "depalmitoylation assay" . [] oboInOwl:hasDbXref "PMID:14760721" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0996 ; owl:annotatedTarget "Measures the removal of N6-formyl-L-lysine, which is cleaved and returns a K residue." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0996 ; owl:annotatedTarget "deformylase reaction" . [] oboInOwl:hasDbXref "PMID:14760721" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0997 ; owl:annotatedTarget "Measures the reversible reaction that creates a covalent bond between a C-terminus G of ubiquitin and a K residue of the target." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0997 ; owl:annotatedTarget "ubiquitinase assay" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0104 ; owl:annotatedTarget "sls" . [] oboInOwl:hasDbXref "PMID:14760721" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0998 ; owl:annotatedTarget "Measures the cleavage of the G-K bond and release of ubiquitin or ubiquitin like proteins." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0998 ; owl:annotatedTarget "deubiquitinase assay" . [] oboInOwl:hasDbXref "PMID:14760721" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0999 ; owl:annotatedTarget "Measurement of the reaction that can affect K or G residues. Reside is functionalised with a formyl group." . [] oboInOwl:hasDbXref "PMID:14760721" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1000 ; owl:annotatedTarget "Measurement of the irreversible introduction of a hydroxyl group that can affect K,P,Y or R residues." . [] oboInOwl:hasDbXref "PMID:14760721" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1001 ; owl:annotatedTarget "The covalent binding of a lipid group to a peptide chain." . [] oboInOwl:hasDbXref "PMID:14707621" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1002 ; owl:annotatedTarget "Measurement of the irreversible covalent addition of a myristoyl group via an amide bond to the alpha-amino group of an amino acid." . [] oboInOwl:hasDbXref "PMID:14760721" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1003 ; owl:annotatedTarget "Measurement of the attachment of one or two 20-carbon lipophilic geranylgeranyl isoprene units from geranylgeranyl diphosphate to one or more cysteine residue(s)." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1003 ; owl:annotatedTarget "geranylgeranylase" . [] oboInOwl:hasDbXref "PMID:14760721" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1004 ; owl:annotatedTarget "Measurement of the covalent attachment of palmitic acid to a protein." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1004 ; owl:annotatedTarget "palmitoylase assay" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0105 ; owl:annotatedTarget "Methods based on 3D structure information." . [] oboInOwl:hasDbXref "PMID:14760721" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1005 ; owl:annotatedTarget "Measurement of the addition of one or more ADP-ribose moieties to molecules." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1005 ; owl:annotatedTarget "adp ribosylase" . [] oboInOwl:hasDbXref "PMID:14760721" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1006 ; owl:annotatedTarget "Measurement of the removal of a glycosyl residue to one or more monomeric units in a polypeptide, polynucleotide, polysaccharide, or other biological polymer." . [] oboInOwl:hasDbXref "PMID:14760721" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1007 ; owl:annotatedTarget "Measurement of the covalently attachment of glycosyl residues to one or more monomeric units in a polypeptide, polynucleotide, polysaccharide, or other biological polymer." . [] oboInOwl:hasDbXref "PMID:14760721" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1008 ; owl:annotatedTarget "Measurement of the reversible reaction that creates a covalent bond between a C-terminus G of an ubiquitine like sumo protein and a K residue of the target." . [] oboInOwl:hasDbXref "PMID:14760721" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1009 ; owl:annotatedTarget "Measurement of the reaction that breaks a covalent bond between a C-terminus G of an ubiquitine like sumo protein and a K residue of the target." . [] oboInOwl:hasDbXref "PMID:14760721" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1010 ; owl:annotatedTarget "Measurement of a reversible reaction that create a covalent bond between a Glycine residue of an ubiquitine like NEDD8 protein and a lysine residue of the target." . [] oboInOwl:hasDbXref "PMID:14760721" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1011 ; owl:annotatedTarget "Measurement of the reaction that breaks a covalent bond between a Glycine residue of an ubiquitine like NEDD8 protein and a lysine residue of the target." . [] oboInOwl:hasDbXref "PMID:117222181" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1012 ; owl:annotatedTarget "38 amino acid (MDEKTTGWRGGHWEGLAGELEQLRARLEHHPQGQREP) Streptavidin binding peptide." . [] oboInOwl:hasDbXref "PMID:19884133" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1013 ; owl:annotatedTarget """Genome browser complementary to Ensembl which extends the search space across a broader taxonomic range. http://www.ensemblgenomes.org""" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0105 ; owl:annotatedTarget "predict from struct" . [] a owl:Axiom ; rdfs:label "http://ensemblgenomes.org/search/eg/${ac}" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_1013 ; owl:annotatedTarget "search-url:" . [] oboInOwl:hasDbXref "PMID:18940858" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1014 ; owl:annotatedTarget "STRING is a database and web resource dedicated to protein interactions, including both physical and functional interactions. It weights and integrates information from numerous sources, including experimental repositories, computational prediction methods and public text collections, thus acting as a meta-database that maps all interaction evidence onto a common set of genomes and proteins." . [] a owl:Axiom ; rdfs:label "DDB_G(0-9){7}" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_1015 ; owl:annotatedTarget "id-validation-regexp:" . [] oboInOwl:hasDbXref "PMID:15695095", "PMID:17711354" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1016 ; owl:annotatedTarget "Slow rate of FRAP recovery when molecule is bound to another compared to inert, non-binding molecule taken as a measure of an interaction." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1016 ; owl:annotatedTarget "frap" . [] oboInOwl:hasDbXref "PMID:18265380" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1017 ; owl:annotatedTarget "Proteins are crosslinked to nucleic acids, for example by the addition of formaldehyde. RNA sequences that cross-link with a given protein are isolated by immunoprecipitation of the protein, and reversal of the cross-linking permits recovery and quantitative analysis of the immunoprecipitated RNA by reverse transcription PCR." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1017 ; owl:annotatedTarget "rna-ip" . [] oboInOwl:hasDbXref "PMID:8322616" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1018 ; owl:annotatedTarget "A database of protein post translational modifications. www.abrf.org/index.cfm/dm.home" . [] oboInOwl:hasDbXref "PMID:19795889" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1020 ; owl:annotatedTarget "A carbonyl-reactive fluorescent labelling dye." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1020 ; owl:annotatedTarget "hilyte 488" . [] oboInOwl:hasDbXref "PMID:9299343" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0106 ; owl:annotatedTarget "Surface patches are built using 6 criteria: solvation potential, residue interface propensity, hydrophobicity, planarity, protrusion and accessible surface area. Protein structures having similar patches are likely to have the same interactions." . [] oboInOwl:hasDbXref "PMID:959835" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1022 ; owl:annotatedTarget "A separation technique where a field is applied to a mixture perpendicular to the mixtures flow. The filed can be graviational, centrifugal, magnetic or a cross flow of fluids." . [] oboInOwl:hasDbXref "PMID:19935683" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1023 ; owl:annotatedTarget "A nonfluorescent, biarsenical derivative of fluorescein. LumioGreen is supplied pre-complexed to EDT, is membrane-permeable, and readily enters the cell." . [] oboInOwl:hasDbXref "PMID:20463740" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1024 ; owl:annotatedTarget "A type of electron microscope that images the sample surface by scanning it with a high-energy beam of electrons in a raster scan pattern. The electrons interact with the atoms that make up the sample producing signals that contain information about the sample's surface topography, composition and other properties such as electrical conductivity." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1024 ; owl:annotatedTarget "sem" . [] oboInOwl:hasDbXref "PMID:15174123" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1025 ; owl:annotatedTarget "A database of protein modifications for mass spectrometry. www.unimod.org" . [] oboInOwl:hasDbXref "PMID:14760721" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1026 ; owl:annotatedTarget "Measurement of a modification that converts an L-histidine residue to diphthamide." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1026 ; owl:annotatedTarget "diphtamidase" . [] oboInOwl:hasDbXref "PMID:14760721" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1027 ; owl:annotatedTarget "A modification that converts an L-histidine residue to diphthamide." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1027 ; owl:annotatedTarget "diphthamidation" . [] oboInOwl:hasDbXref "PMID:19106085" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1028 ; owl:annotatedTarget "Chromatin-bound protein networks isolated using magnetic beads coated with antibodies." . [] oboInOwl:hasDbXref "PMID:11896282", "PMID:12120258", "PMID:16338355" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0107 ; owl:annotatedTarget "This method measures formation of complex by monitoring changes in the resonance angle of light impinging on a gold surface as a result of changes in the refractive index of the surface. A ligand of interest (small molecule, peptide, protein, sugar, lipid, nucleic acid) is immobilized on a gold surface, and the interacting partner is injected in buffer flow over it. Biomolecules that interact with the immobilized ligand are retained on the surface, and alter the resonance angle of impinging light as a result of the change in refractive index brought about by the increased biomolecule mass retained on the surface. Since all the biomolecules belonging to the same class have the same refractive index and since there is a linear correlation between resonance angle shift and biomolecule concentration near the surface, this allows one to measure changes in concentration at the surface as a consequence of interaction. Furthermore, this is done in real time, allowing direct measurement of both the on-rate and the off-rate and of the affinity constant of complex formation." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1028 ; owl:annotatedTarget "mch-ip" . [] oboInOwl:hasDbXref "PMID:19135898" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1029 ; owl:annotatedTarget "Specific nucleic acid probes are fixed to solid supports (e.g. beads) and act as affinity probes. The molecules associated with the nucleic acid probes can then be isolated and identified." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1029 ; owl:annotatedTarget "pich" . [] oboInOwl:hasDbXref "PMID:18480256" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1030 ; owl:annotatedTarget "Excimer (excited-dimer) fluorescence is produced by complexes formed by two molecules, at least one of which is in an excited state. It is characterized by a lower energy (i.e. red shift) than fluorescence of a single, non-interacting molecule." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1030 ; owl:annotatedTarget "excimer fluoresc" . [] oboInOwl:hasDbXref "PMID:19940245" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1031 ; owl:annotatedTarget "A change in the rate of protein folding/unfolding is taken as a measure of chaperone protein binding." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1031 ; owl:annotatedTarget "protein folding" . [] oboInOwl:hasDbXref "PMID:14760721" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1032 ; owl:annotatedTarget "Fluorescent tag - maleimide couples to thiols." . [] oboInOwl:hasDbXref "PMID:14760721" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1033 ; owl:annotatedTarget "Fluorescent tag - maleimide couples to thiols." . [] oboInOwl:hasDbXref "PMID:14760721" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1034 ; owl:annotatedTarget "Measures the cleavage of phosphodiesterase bonds between the nucleotide subunits of nucleic acids." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0107 ; owl:annotatedTarget "BIAcore(r)" . [] oboInOwl:hasDbXref "PMID:14760721" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1035 ; owl:annotatedTarget "Measures the catalysis of the hydrolysis of phosphodiester bonds in chains of DNA." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1035 ; owl:annotatedTarget "deoxyribonuclease" . [] oboInOwl:hasDbXref "PMID:14760721" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1036 ; owl:annotatedTarget """Experiments monitoring interactions of nucleotide exchange factors with their cognate nucleotidases.""" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1036 ; owl:annotatedTarget "nucleotide exchange" . [] oboInOwl:hasDbXref "PMID:12705589", "PMID:22070901" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1037 ; owl:annotatedTarget "The N-terminal portion of synthetic renilla luciferase (hrluc) is attached to one protein through the linker peptide (GGGS)2 and C-terminal portion of synthetic renilla luciferase is connected to the second protein through the linker (GGGGS)2. Interaction of the 2 proteins recovers hrluc activity and produces light." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1037 ; owl:annotatedTarget "renilla luciferase" . [] oboInOwl:hasDbXref "PMID:20080536" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1038 ; owl:annotatedTarget "Measures selective electrical response to molecules binding to the immobilised bait." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1038 ; owl:annotatedTarget "nanowire transistor" . [] oboInOwl:hasDbXref "PMID:14760721" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1039 ; owl:annotatedTarget "The C-terminal region of a sequence, exact coordinates not available." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1039 ; owl:annotatedTarget "c-term range" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0107 ; owl:annotatedTarget "Optical biosensor" . [] oboInOwl:hasDbXref "PMID:14760721" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1040 ; owl:annotatedTarget "The N-terminal region of a sequence, exact coordinates not available." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1040 ; owl:annotatedTarget "n-term range" . [] oboInOwl:hasDbXref "PMID:14681455" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1041 ; owl:annotatedTarget "Alternative name or descriptor for an entity." . [] oboInOwl:hasDbXref "PMID:12519941" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1042 ; owl:annotatedTarget "PubMed Central is the US National Institute of Health free digital archive of biomedical and life science journals." . [] a owl:Axiom ; rdfs:label "http://europepmc.org/abstract/PMC/${ac}" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_1042 ; owl:annotatedTarget "search-url:" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1042 ; owl:annotatedTarget "pmc" . [] oboInOwl:hasDbXref "PMID:19126575" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1043 ; owl:annotatedTarget "A repository for collecting, storing and and searching the annotation of gene or protein expression patterns in Drosophila melongaster. CPTI (Cambridge Protein Trap Identifier)" . [] a owl:Axiom ; rdfs:label "CPTO-[0-9]{6}" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_1043 ; owl:annotatedTarget "id-validation-regexp:" . [] oboInOwl:hasDbXref "PMID:17145706" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1044 ; owl:annotatedTarget "NSF funded annotation project." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1045 ; owl:annotatedTarget "Indicates source, depth and standards by which an entry has been added to a database." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0107 ; owl:annotatedTarget "spr" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1046 ; owl:annotatedTarget "Defines an interaction by the type of binary molecule pairs it can generates." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1047 ; owl:annotatedTarget "Interaction between a protein or peptide and a corresponding protein or peptide." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1048 ; owl:annotatedTarget "Interaction between a small molecule and a corresponding protein or peptide." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1049 ; owl:annotatedTarget "Interaction between a nucleic acid and a corresponding protein or peptide." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1050 ; owl:annotatedTarget "Provides an indication of the level of post-processing of experimental data relating to specific binary pairs" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1051 ; owl:annotatedTarget "Binary pair is defined by a single piece of experimental evidence." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1052 ; owl:annotatedTarget "Binary pair is defined by multiple pieces of experimental evidence which have been clustered together." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1053 ; owl:annotatedTarget "The source of the data entered into the database." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1054 ; owl:annotatedTarget "Data has been directly curated into the database from the paper describing the experimental evidence or by direct submission by the experimenter." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1055 ; owl:annotatedTarget "Data has been directly curated into this database from the paper describing the experimental evidence" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0011 ; owl:annotatedTarget "beta lactamase" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0108 ; owl:annotatedTarget "T7 is a double stranded DNA bacteriophage with a thin-walled icosahedral capsid, ~550 Angstrom in diameter, which is decorated by 415 copies of the capsid protein, the product of gene 10. gp10 can tolerate insertions at the carboxyterminus without loosing its ability to be inserted into functional phage capsids. Both low density and high density display (albeit only with short peptides) can be achieved." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1056 ; owl:annotatedTarget "The data has been entered into the database following extraction from the literature by a computational process." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1057 ; owl:annotatedTarget "The interaction has been predicted using a specific algorithm." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1058 ; owl:annotatedTarget "The data has been imported into the database form an external resource." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1059 ; owl:annotatedTarget "The method by which complex n-ary data is expanded into binary data. This may be performed manually on data input, or computationally on data export." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1060 ; owl:annotatedTarget "Complex n-ary data has been expanded to binary using the spoke model. This assumes that all molecules in the complex interact with a single designated molecule, usually the bait." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1061 ; owl:annotatedTarget "Complex n-ary data has been expanded to binary using the spoke model. This assumes that all molecules in the complex interact with each other." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1062 ; owl:annotatedTarget "Complex n-ary data has been expanded to binary using the bipartite model. This assumes that all molecules in the complex interact with a single externally designated entity." . [] oboInOwl:hasDbXref "PMID:21071422" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1063 ; owl:annotatedTarget "ConsensusPathDB-human integrates functional interaction networks including complex protein-protein, metabolic, signaling and gene regulatory interaction networks in Homo sapiens. Data originate from currently 20 public resources for functional interactions (listed below), as well as interactions that we have curated from literature. Data are integrated in a complementary manner and redundancies are avoided." . [] oboInOwl:hasDbXref "PMID:19420069" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1064 ; owl:annotatedTarget "A method used to derive a numerical or empirical measure of confidence in a particular interaction, or in the identification of the participants in an interaction." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1064 ; owl:annotatedTarget "confidence" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0108 ; owl:annotatedTarget "t7 phage" . [] oboInOwl:hasDbXref "PMID:19420069" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1065 ; owl:annotatedTarget "Methods based on counting the number of replicates in which an interaction has been observed." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1065 ; owl:annotatedTarget "replication score" . [] oboInOwl:hasDbXref "PMID:15044803" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1066 ; owl:annotatedTarget "Confidence score based on similarity to interacting molecules of known structure, presence of known interacting domains etc." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1066 ; owl:annotatedTarget "structure score" . [] oboInOwl:hasDbXref "PMID:21443973" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1067 ; owl:annotatedTarget "Confidence in an interaction is based on shared functionality of interacting molecules e.g. co-occurrence of GO function terms." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1067 ; owl:annotatedTarget "function score" . [] oboInOwl:hasDbXref "PMID:18624398" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1068 ; owl:annotatedTarget "Confidence in an interaction is based on shared functionality of interacting molecules e.g. co-occurrence of GO component terms or co-occurrence in the same tissues." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1068 ; owl:annotatedTarget "colocation score" . [] oboInOwl:hasDbXref "PMID:19010802" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1069 ; owl:annotatedTarget """Network-based confidence scoring systems assign confidence based on multiple parameters, potentially shared by interacting proteins e.g. interaction partners, topological parameters, comparison with genetic interactions.""" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1069 ; owl:annotatedTarget "network score" . [] oboInOwl:hasDbXref "PMID:10504710" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0109 ; owl:annotatedTarget """The TAP method involves the fusion of the TAP tag (encoding a calmodulin binding peptide, a TEV cleavage site, and the Staphylococcus aureus Protein A) to the target protein and the introduction of the construct into the host cell or organism, maintaining the expression of the fusion protein at, or close to, its natural level. The fusion protein and associated components are recovered from cell extracts by affinity selection on an IgG matrix. After washing, the TEV protease is added to release the bound material. The eluate is incubated with calmodulin-coated beads in the presence of calcium. This second affinity step is required to remove the TEV protease as well as traces of contaminants remaining after the first affinity selection. After washing, the bound material is released with EGTA. This two steps purification steps ensures a highly selective complex purification of the tapped protein (first round of selection on the protein A, a high affinity tag) under mild condition (non denaturant pH or conditions required to remove the tag). OBSOLETE redundant term. Map to feature type: tap tagged (MI:0524) and as interaction detection method tandem affinity purification (MI:0676).""" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1069 ; owl:annotatedTarget "network-based scoring system" . [] oboInOwl:hasDbXref "PMID:16554755" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1070 ; owl:annotatedTarget "Confidence scoring system based on comparison to a 'gold standard' set of known interacting molecules." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1070 ; owl:annotatedTarget "standard score" . [] oboInOwl:hasDbXref "PMID:18005433" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1071 ; owl:annotatedTarget "Confidence in an interaction is based on co-occurrence of an interacting pair or molecules in the same article, or sentence within an article, usually identified by text-mining." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1071 ; owl:annotatedTarget "literature score" . [] oboInOwl:hasDbXref "PMID:19420069" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1072 ; owl:annotatedTarget "The confidence of an interaction is assessed on the number of different methods by which it is observed." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1072 ; owl:annotatedTarget "method score" . [] oboInOwl:hasDbXref "PMID:19420069" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1073 ; owl:annotatedTarget "Confidence in an interaction is based on a measure of the probability of these molecules interacting." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1073 ; owl:annotatedTarget "statistical score" . [] oboInOwl:hasDbXref "PMID:19223579" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1074 ; owl:annotatedTarget "The protein of interest is expressed as a fusion to a RGS(His)n tag." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0109 ; owl:annotatedTarget "tap tag coip" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1074 ; owl:annotatedTarget "rgs-his" . [] oboInOwl:hasDbXref "PMID:ID:11604014" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1075 ; owl:annotatedTarget "The Beilstein database is in the field of organic chemistry, in which compounds are uniquely identified by their Beilstein Registry Number." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1075 ; owl:annotatedTarget "beilstein" . [] oboInOwl:hasDbXref "PMID:17125194" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1076 ; owl:annotatedTarget "The EINECS database provides general information such as CAS number, EINECS number, Substance Name and Chemical Formula for 100,204 chemical substances. Where available each compound entry is linked to risk and safety phrases and IUCLID and OECD chemical data sheets." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1076 ; owl:annotatedTarget "einecs" . [] oboInOwl:hasDbXref "PMID:17832605" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1077 ; owl:annotatedTarget "Comprehensive information on chemicals, drugs, and biologicals." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1077 ; owl:annotatedTarget "merck index" . [] oboInOwl:hasDbXref "PMID:18063570" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1078 ; owl:annotatedTarget "PlantGDB develops plant species-specific EST and GSS databases, to provide web-accessible tools and inter-species query capabilities, and to provide genome browsing and annotation capabilities." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1078 ; owl:annotatedTarget "plantgdb" . [] oboInOwl:hasDbXref "PMID:15608244" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1079 ; owl:annotatedTarget "The rat genome database RatMap (http://ratmap.org or http://ratmap.gen.gu.se) has been one of the main resources for rat genome information since 1994. The database is maintained by CMB Genetics at Gothenburg University in Sweden and provides information on rat genes, polymorphic rat DNA-markers and rat quantitative trait loci (QTLs), all curated at RatMap." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0110 ; owl:annotatedTarget "Text mining methods can be used to predict or confirm interactions by automated processing of scientific literature. Co-occurrence in the same sentence of an abstract of gene products labels are analysed to evaluate whether it represents a valid evidence of an interaction." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1079 ; owl:annotatedTarget "ratmap" . [] oboInOwl:hasDbXref "PMID:20521243" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1080 ; owl:annotatedTarget "The Arabidopsis Information Resource (TAIR) maintains a database of genetic and molecular biology data for the model higher plant Arabidopsis thaliana . Data available from TAIR includes the complete genome sequence along with gene structure, gene product information, metabolism, gene expression, DNA and seed stocks, genome maps, genetic and physical markers, publications, and information about the Arabidopsis research community." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1080 ; owl:annotatedTarget "tair" . [] oboInOwl:hasDbXref "PMID:18287690" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1081 ; owl:annotatedTarget "The J. Craig Venter Institute was formed in October 2006 through the merger of several affiliated and legacy organizations including The Institute for Genomic Research (TIGR)." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1081 ; owl:annotatedTarget "The Institute for Genomic Research" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1081 ; owl:annotatedTarget "tigr/jcvi" . [] oboInOwl:hasDbXref "PMID:21036866" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1082 ; owl:annotatedTarget "Extensive information on Danio rerio, including genomics databases, developmental stages, publications and molecular tools." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1082 ; owl:annotatedTarget "zfin" . [] oboInOwl:hasDbXref "PMID:11125040" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1083 ; owl:annotatedTarget "Clusters of Orthologous Groups of proteins (COGs) were delineated by comparing protein sequences encoded in complete genomes, representing major phylogenetic lineages. Each COG consists of individual proteins or groups of paralogs from at least 3 lineages and thus corresponds to an ancient conserved domain." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1083 ; owl:annotatedTarget "cogg" . [] oboInOwl:hasDbXref "PMID:10318894" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0111 ; owl:annotatedTarget "The gene for DHFR is rationally dissected into two fragments called F[1,2] and F[3]. Two proteins or protein domains that are thought to bind to each other can then be fused to either of the two DHFR fragments. Reconstitution of enzyme activity can be monitored in vivo by cell survival in DHFR-negative cells grown in the absence of nucleotides. A fluorescence assay can also be carried out taking advantage of fMTX binding to reconstituted DHFR. The basis of this assay is that complementary fragments of DHFR, when expressed and reassembled in cells, will bind with high affinity (Kd 5 540 pM) to fMTX in a 1:1 complex. fMTX is retained in cells by this complex, whereas the unbound fMTX is actively and rapidly transported out of the cells. Survival depends only on the number of molecules of DHFR reassembled." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1084 ; owl:annotatedTarget "Any molecule that is able to transfer a photon to another chemical species." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1084 ; owl:annotatedTarget "photon donor" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1085 ; owl:annotatedTarget "Molecule to which a photon may be transferred from an photon donor." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1085 ; owl:annotatedTarget "photon acceptor" . [] oboInOwl:hasDbXref "PMID:21609686" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1086 ; owl:annotatedTarget "Two chambers are separated by a dialysis membrane. The molecular weight cut off (MWCO) of this membrane is chosen such that it will retain the receptor component of the sample (the element which will bind the ligand). A known concentration and volume of ligand is placed into one of the chambers. The ligand is small enough to pass freely through the membrane. A known concentration of receptor is then placed in the remaining chamber in an equivalent volume to that placed in the first chamber. As the ligand diffuses across the membrane some of it will bind to the receptor and some will remain free in solution. The higher the affinity of the interaction, the higher the concentration of ligand that will be bound at any time." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1086 ; owl:annotatedTarget "equilib. dialysis" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1087 ; owl:annotatedTarget "Method to block a binding site on a molecule, such as a protein, using a monoclonal antibody to test that the binding site is involved in an interaction with another molecule." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1087 ; owl:annotatedTarget "mab blockade" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1088 ; owl:annotatedTarget "Assays that are used to determine interactions by monitoring, for example activation of a certain pathway when screening for inhibitors of a given receptor." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1088 ; owl:annotatedTarget "phenotype-based" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0111 ; owl:annotatedTarget "dhfr reconstruction" . [] oboInOwl:hasDbXref "PMID:21684252" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1089 ; owl:annotatedTarget "Method to detect interaction by inducing nuclear localization of one participant, which would then pull an interacting participant along with it into the nucleus. As both participants are labeled, the difference in nuclear localization between the induced and non-induced states provides an indication of the interaction between the two molecules." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1089 ; owl:annotatedTarget "nuclear translocation" . [] oboInOwl:hasDbXref "PMID:7378449" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1090 ; owl:annotatedTarget "Bromobimanes are low molecular weight non-fluorescent alkyl halides which react with thiol groups to produce highly fluorescent derivatives. The bimane labels, monobromobimane, dibromobimane, and monobromotrimethylammoniobimane, are derivatives of syn-9,10-dioxabimane:1,5-diazabicyclo[3.3.0]octa-3,6-diene-2,8-dione." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1090 ; owl:annotatedTarget "bimane" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1091 ; owl:annotatedTarget "Title of the publication." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1091 ; owl:annotatedTarget "title" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1092 ; owl:annotatedTarget "Fluorescent dyes - spectral range 500 to 700 nm." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1092 ; owl:annotatedTarget "atto label" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1093 ; owl:annotatedTarget "Attributes specific to the publication." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1093 ; owl:annotatedTarget "bib attribute" . [] oboInOwl:hasDbXref "PMID:9560251" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0112 ; owl:annotatedTarget "The split-ubiquitin system provides a method for examining the interactions of membrane proteins. In the split-ubiquitin system, two integral membrane proteins to be studied are fused to two different ubiquitin moieties: a C-terminal ubiquitin moiety (\"Cub\", residues 35-76) and an N-terminal ubiquitin moiety (\"Nub\", residues 1-34). These fused proteins are called the bait and prey, respectively. In addition to being fused to an integral membrane protein, the Cub moiety is also fused to a transcription factor that can be cleaved off by ubiquitin specific proteases. Upon bait-prey interaction, Nub and Cub-moieties assemble, reconstituting the split-ubiquitin. The reconstituted split-ubiquitin molecule is recognized by ubiquitin specific proteases, which cleave off the reporter protein, allowing it to induce the transcription of reporter genes." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1094 ; owl:annotatedTarget "Databases which are the responsible for the maintenance and subsequent annotation of one or more genomic sequences." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1094 ; owl:annotatedTarget "genome databases" . [] oboInOwl:hasDbXref "PMID:20929869" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1095 ; owl:annotatedTarget "HGNC is the nomenclature committee responsible for the naming of human genes." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1095 ; owl:annotatedTarget "Human Genome Nomenclature Committee" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1095 ; owl:annotatedTarget "hgnc" . [] oboInOwl:hasDbXref "PMID:21447597" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1096 ; owl:annotatedTarget "Databases dedicated to the collection and annotation of protein sequences." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1096 ; owl:annotatedTarget "protein seq db" . [] oboInOwl:hasDbXref "PMID:21051339" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1097 ; owl:annotatedTarget "UniProt is a centralized repository of protein sequences with comprehensive coverage and a systematic approach to protein annotation, incorporating, interpreting, integrating and standardizing data from numerous sources and is the most comprehensive catalog of protein sequences and functional annotation." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1097 ; owl:annotatedTarget "uniprot" . [] oboInOwl:hasDbXref "PMID:14681372", "PMID:21447597" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1098 ; owl:annotatedTarget """UniProt (Universal Protein Resource) is the world's most comprehensive catalogue of information on proteins. It is a central repository of protein sequence and function created by joining the information contained in Swiss-Prot, TrEMBL, and PIR. UniProtKB/Swiss-Prot is manually curated which means that the information in each entry is annotated and reviewed by a curator. http://www.uniprot.org""" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0112 ; owl:annotatedTarget "ub reconstruction" . [] a owl:Axiom ; rdfs:label "(([OPQ][0-9][A-Z0-9]{3}[0-9]|[A-NR-Z][0-9]([A-Z][A-Z0-9]{2}[0-9]){1,2})(-[0-9]+)?(-PRO_[0-9]{10})?)" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_1098 ; owl:annotatedTarget "id-validation-regexp:" . [] a owl:Axiom ; rdfs:label "https://www.uniprot.org/uniprotkb/${ac}/entry" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_1098 ; owl:annotatedTarget "search-url:" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1098 ; owl:annotatedTarget "UniProt" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1098 ; owl:annotatedTarget "swiss-prot" . [] oboInOwl:hasDbXref "PMID:14681372", "PMID:21447597" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1099 ; owl:annotatedTarget """UniProt (Universal Protein Resource) is the world's most comprehensive catalogue of information on proteins. It is a central repository of protein sequence and function created by joining the information contained in Swiss-Prot, TrEMBL, and PIR. The records in UniProtKB/TrEMBL are automatically generated and are enriched with automatic annotation and classification. http://www.uniprot.org""" . [] a owl:Axiom ; rdfs:label "(([OPQ][0-9][A-Z0-9]{3}[0-9]|[A-NR-Z][0-9]([A-Z][A-Z0-9]{2}[0-9]){1,2})(-[0-9]+)?(-PRO_[0-9]{10})?)" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_1099 ; owl:annotatedTarget "id-validation-regexp:" . [] a owl:Axiom ; rdfs:label "https://www.uniprot.org/uniprotkb/${ac}/entry" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_1099 ; owl:annotatedTarget "search-url:" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1099 ; owl:annotatedTarget "UniProt" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1099 ; owl:annotatedTarget "trembl" . [] oboInOwl:hasDbXref "PMID:14760721" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1100 ; owl:annotatedTarget "Molecules showing activity in a living system but not encoded by a genomic sequence." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0113 ; owl:annotatedTarget "Western blot is a procedure to identify and quantify proteins. A mixture of protein is first submitted to an electrophoresis in denaturing condition and then electro-transferred from the gel to a membrane. The membrane is then incubated with a primary antibody specific for a given protein or a specific residue modification in the sample under analysis. A secondary antibody, radiolabelled or fused to fluorophore or to a chromogenic enzyme, targets the first antibody and allows the visualisation of the protein band on the membrane." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1100 ; owl:annotatedTarget "bioactive entity" . [] oboInOwl:hasDbXref "PMID:23343401" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1101 ; owl:annotatedTarget "The Standard InChIKey has five distinct components, a 14-character hash of the basic (Mobile-H) InChI layer, an 8-character hash of the remaining layers (except for the /p segment, which accounts for added or removed protons: it is not hashed at all; the number of protons is encoded at the end of the standard InChIKey.) , a 1 flag character, a 1 version character and the last character is a [de]protonation indicator. The overall length of InChIKey is fixed at 27 characters, including separators (dashes)." . [] oboInOwl:hasDbXref "PMID:14760721" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1102 ; owl:annotatedTarget "Sequence has been computationally remapped following removal or update of the original sequence in the underlying sequence database." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1102 ; owl:annotatedTarget "mapped-identity" . [] oboInOwl:hasDbXref "PMID:20951674" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1103 ; owl:annotatedTarget """NMR solution state analysis provides useful data regarding the type, quantity and arrangement of different atoms in chemical systems, liquids and solids. Samples are dissolved in deuterated solvents and spectra consist of a series of very sharp transitions, due to averaging of anisotropic NMR interactions by rapid random tumbling. Solution-state NMR only requires that the molecule be soluble at sufficient concentration for data collection, but becomes increasingly difficult for biomolecules over 30 kDa so that a practical size limitation is placed on full structure determinations.""" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1103 ; owl:annotatedTarget "solution nmr" . [] oboInOwl:hasDbXref "PMID:20951674" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1104 ; owl:annotatedTarget """Solid-state NMR (ssNMR) does not require that the sample be soluble or form a crystal, and the approach can be used to study molecules larger than 100 kD. Solid-state NMR spectra are very broad, as the full effects of anisotropic or orientation-dependent interactions are observed in the spectrum.""" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1104 ; owl:annotatedTarget "solid state nmr" . [] oboInOwl:hasDbXref "PMID:19850718" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1105 ; owl:annotatedTarget "BioCyc is a collection of Pathway/Genome Databases. Each database in the BioCyc collection describes the genome and metabolic pathways of a single organism. (http://biocyc.org/)." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1105 ; owl:annotatedTarget "biocyc" . [] oboInOwl:hasDbXref "PMID:10725388", "PMID:9874787" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0012 ; owl:annotatedTarget "In this variation of the FRET assay the donor fluorophore is replaced by a luciferase (typically Renilla luciferase). In the presence of its substrate, the luciferase catalyses a bioluminescent reaction that excites the acceptor fluorophore through a resonance energy transfer mechanism. As with FRET the energy transfer occurs only if the protein fused to the luciferase and the one fused to the acceptor fluorophore are in close proximity (10-100 Angstrom)." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0113 ; owl:annotatedTarget "Immuno blot" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1106 ; owl:annotatedTarget "Databases which primarily exist to display biomolecular information in structured pathways. Interactions data can be inferred from the published pathways." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1106 ; owl:annotatedTarget "pathways db" . [] oboInOwl:hasDbXref "PMID:18832364" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1107 ; owl:annotatedTarget "Curated collection of information about known biomolecular interactions and key cellular processes assembled into signaling pathways. It is a collaborative project between the US National Cancer Institute (NCI) and Nature Publishing Group (NPG), and is an open access online resource (http://pid.nci.nih.gov/)." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1107 ; owl:annotatedTarget "pid" . [] oboInOwl:hasDbXref "PMID:14760721" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1108 ; owl:annotatedTarget "BioCarta, whose core business is in assays and reagents, has also developed a collection of diagrams representing molecular and cellular signal transduction pathways." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1108 ; owl:annotatedTarget "biocarta" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1109 ; owl:annotatedTarget "Primarily nomenclature/cross-reference databases, used by curators to establish a link between a gene and protein ID. In some cases, database records do not contain actual sequence but point to loci on specific reference genomes." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1109 ; owl:annotatedTarget "gene dbs" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1110 ; owl:annotatedTarget "Interaction has been predicted by either interologue mapping, by an algorithm or by a computational method." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1110 ; owl:annotatedTarget "predicted" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0114 ; owl:annotatedTarget "Analysis of a diffraction pattern generated by a single crystal. X-rays have a wavelength, typically around 1 Angstrom (the diameter of a hydrogen atom). If a narrow parallel beam of X-rays is directed at a sample of a pure protein, most of the X-rays will pass straight through it. A small fraction, however, will be scattered by the atoms in the sample. If the sample is a well-ordered crystal, the scattered waves will reinforce one another at certain points and will appear as diffraction spots when the X-rays are recorded by a suitable detector. The position and intensity of each spot in the X-ray diffraction pattern contain information about the position and nature of the atoms in the crystal. The three-dimensional structure of a large molecule can be deduced from the electron-density map of its crystal. In recent years X-ray diffraction analysis has become increasingly automated, and now the slowest step is likely to be the production of suitable macromolecule crystals. This requires high concentration of very pure macromolecule and empirical searching for the proper crystallization conditions." . [] oboInOwl:hasDbXref "PMID:11283351", "PMID:20946815" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1111 ; owl:annotatedTarget "Individual baits are mated against pools of preys, or pools of baits are mated against individual preys. This approach required cloning baits and preys into both two-hybrid vectors, followed by pooling sets of transformants. The positive double hybrid clones are the interacting partners." . [] oboInOwl:hasDbXref "PMID:20946815" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1112 ; owl:annotatedTarget "Individual baits are mated against pools of preys. This approach required cloning baits and preys into both two-hybrid vectors, followed by pooling sets of transformants. The positive double hybrid clones are the interacting partners." . [] oboInOwl:hasDbXref "PMID:10655498" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1113 ; owl:annotatedTarget "def" . [] oboInOwl:hasDbXref "PMID:18984613" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1114 ; owl:annotatedTarget "A database of viral-host interactions." . [] oboInOwl:hasDbXref "PMID:21097778" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1115 ; owl:annotatedTarget "SPIKE" . [] oboInOwl:hasDbXref "PMID:20576703" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1116 ; owl:annotatedTarget "GeneMANIA predicts interactions based on multiple evidences including physical and genetic interactions, pathways, co-localisation, co-expression and protein domain similarity." . [] oboInOwl:hasDbXref "PMID:21822272" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1117 ; owl:annotatedTarget "TopFIND provides information on protein N- and C-termini. Information of proteases and their substrates is provided." . [] oboInOwl:hasDbXref "PMID:10929120" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1118 ; owl:annotatedTarget "A variation of yellow fluorescent protein derived from eGFP." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1118 ; owl:annotatedTarget "eyfp" . [] oboInOwl:hasDbXref "PMID:11983170" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1119 ; owl:annotatedTarget "n-terminal fragment of yellow fluorescent protein used as a tag in bimolecular fluorescence complementation (BiFC)." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0114 ; owl:annotatedTarget "X-ray" . [] oboInOwl:hasDbXref "PMID:11983170" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1120 ; owl:annotatedTarget "c-terminal fragment of yellow fluorescent protein used as a tag in bimolecular fluorescence complementation (BiFC)." . [] oboInOwl:hasDbXref "PMID:11983170" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1121 ; owl:annotatedTarget "c-terminal fragment of enhanced yellow fluorescent protein used as a tag in bimolecular fluorescence complementation (BiFC)." . [] oboInOwl:hasDbXref "PMID:11983170" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1122 ; owl:annotatedTarget "n-terminal fragment of enhanced yellow fluorescent protein used as a tag in bimolecular fluorescence complementation (BiFC)." . [] oboInOwl:hasDbXref "PMID:11812264", "PMID:11836221", "PMID:11987162", "PMID:17145705" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1123 ; owl:annotatedTarget "BindingDB is a web-accessible public database of experimentally determined protein-ligand binding affinities for drug discovery. http://BindingDB.org" . [] oboInOwl:hasDbXref "PMID:21071392" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1124 ; owl:annotatedTarget """Allows the user to browse and search pathways across multiple public pathway databases. http://www.pathwaycommons.org""" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1125 ; owl:annotatedTarget "The defined region of protein which makes physical contact with the interacting partner." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1125 ; owl:annotatedTarget "direct binding" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1126 ; owl:annotatedTarget "Intra-molecular interaction between two or more regions of the same molecule." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1127 ; owl:annotatedTarget "Interaction between two or more regions of possibly the same molecule but it is also possible that the observation is due to an interaction between two identical molecules." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1128 ; owl:annotatedTarget "Region of a molecule whose mutation or deletion totally disrupts an interaction strength." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0114 ; owl:annotatedTarget "x-ray diffraction" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1128 ; owl:annotatedTarget "mutation disrupting strength" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1129 ; owl:annotatedTarget "Region of a molecule whose mutation or deletion totally disrupts an interaction rate (in the case of interactions inferred from enzymatic reaction).." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1129 ; owl:annotatedTarget "mutation disrupting rate" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1130 ; owl:annotatedTarget "Region of a molecule whose mutation or deletion decreases significantly interaction rate (in the case of interactions inferred from enzymatic reaction)." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1130 ; owl:annotatedTarget "mutation decreasing rate" . [] oboInOwl:hasDbXref "PMID:14577292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1131 ; owl:annotatedTarget "Region of a molecule whose mutation or deletion increases significantly interaction rate (in the case of interactions inferred from enzymatic reaction)." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1131 ; owl:annotatedTarget "mutation increasing rate" . [] oboInOwl:hasDbXref "PMID:14577292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1132 ; owl:annotatedTarget "Region of a molecule whose mutation or deletion increases significantly interaction strength." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1132 ; owl:annotatedTarget "mutation increasing strength" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1133 ; owl:annotatedTarget "Region of a molecule whose mutation or deletion decreases significantly interaction strength." . [] oboInOwl:hasDbXref "PMID:9181578" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0115 ; owl:annotatedTarget "The proteins are displayed on the surface of the yeast S. cerevisiae by fusion to signal sequences for protein secretion. This method is limited by the low efficiency of the yeast display system but can take full advantage of exploiting cell sorting methods (FACS) to isolate cells that display molecules with desired binding properties." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1133 ; owl:annotatedTarget "mutation decreasing strength" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1134 ; owl:annotatedTarget "mcherry" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1135 ; owl:annotatedTarget "Introduction of a point mutation into Aequorea-derived YFP, the substitution of leucine for phenylalanine at position 46 (F46L), produced Venus. This mutation dramatically accelerates oxidation of the chromophore, the rate-limiting step in fluorescent protein maturation. Additional mutations were also introduced in order to increase the tolerance of Venus to acidic environments and to reduce the sensitivity to chloride. The absorption and emission spectral peaks are 515 and 528 nanometers, respectively." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1135 ; owl:annotatedTarget "venus" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1136 ; owl:annotatedTarget "Monomeric coral fluorescent reporter protein." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1136 ; owl:annotatedTarget "kusabira-green" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1137 ; owl:annotatedTarget "The measurement of a the introduction of a carboxylic acid group into a substrate." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1137 ; owl:annotatedTarget "carboxylation assay" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1138 ; owl:annotatedTarget "The measurement of a the introduction of a carboxylic acid group into a substrate." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1138 ; owl:annotatedTarget "decarboxxylation assay" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0116 ; owl:annotatedTarget "Property of a subsequence that may interfere with the binding of a molecule." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1139 ; owl:annotatedTarget "Carboxylation is a posttranslational modification of glutamate residues, to gamma-carboxyglutamate, in proteins." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1139 ; owl:annotatedTarget "carboxylation" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1140 ; owl:annotatedTarget "Decarboxylation is a chemical reaction that releases carbon dioxide (CO2). Usually, decarboxylation refers to a reaction of carboxylic acids, removing a carbon atom from a carbon chain. Enzymes that catalyze decarboxylations are called decarboxylases or, the more formal term, carboxy-lyases (EC number 4.1.1)." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1140 ; owl:annotatedTarget "decarboxylation" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1141 ; owl:annotatedTarget "S-tag is the name of an oligopeptide derived from pancreatic ribonuclease A (RNase A). The amino acid sequence of the S-tag is: Lys-Glu-Thr-Ala-Ala-Ala-Lys-Phe-Glu-Arg-Gln-His-Met-Asp-Ser." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1142 ; owl:annotatedTarget "The measurement of the addition of an aminoacyl group to a compound." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1142 ; owl:annotatedTarget "aminoacylation" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1143 ; owl:annotatedTarget "Aminoacylation is the process of adding an aminoacyl group to a compound." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1143 ; owl:annotatedTarget "aminoacylation" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1144 ; owl:annotatedTarget "Protein A tag is visualized by interacting with IgG antibodies (or their derivatives) that are specifically recognized by protein A." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0117 ; owl:annotatedTarget "A region of a molecule or a component of a complex identified as being involved in an interaction. This may or may not be a region of the molecule in direct contact with the interacting partner." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1144 ; owl:annotatedTarget "protein a visualisation" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1145 ; owl:annotatedTarget "A phospholipase is an enzyme that hydrolyzes phospholipids into fatty acids and other lipophilic substances. There are four major classes, termed A, B, C and D, distinguished by the type of reaction which they catalyze." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1146 ; owl:annotatedTarget "Measurement of the hydrolysis of phospholipids into fatty acids and other lipophilic substances. There are four major classes, termed A, B, C and D, distinguished by the type of reaction which they catalyze." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1147 ; owl:annotatedTarget """Measurement of AMPylation, the formation of a phosphodiester or phosphoramide ester of AMP on Tyr (RESID:AA0203), Lys (RESID:AA0227), Thr (RESID:AA0267), His (RESID:AA0371) and other amino acids.""" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1147 ; owl:annotatedTarget "ampylation assay" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1148 ; owl:annotatedTarget """AMPylation, previously known as adenylylation, is formation of a phosphodiester or phosphoramide ester of AMP on Tyr (RESID:AA0203), Lys (RESID:AA0227), Thr (RESID:AA0267), His (RESID:AA0371) and other amino acids.""" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1148 ; owl:annotatedTarget "ampylation" . [] oboInOwl:hasDbXref "PMID:18641616" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1149 ; owl:annotatedTarget "A set of molecular binding events that influence each other either positively or negatively through allostery or pre-assembly. In this context, covalent post-translational modifications are considered as binding events. CV terms that are part of this term allow the description of cooperative interactions using the current PSI-MI schema." . [] oboInOwl:hasDbXref "PMID:18641616" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1150 ; owl:annotatedTarget "For an interaction that has a cooperative effect on a subsequent interaction, this term indicates which subsequent interaction is affected. The affected interaction is identified by referring to its interaction id." . [] oboInOwl:hasDbXref "PMID:18641616" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1151 ; owl:annotatedTarget "Referring to a previously described interaction as a participant allows the description of ordered assembly of molecular complexes in PSI-MI2.5. When one of the components of the preformed complex has a feature, the participant-ref term indicates on which component this feature is located. The component is identified by referring to its participant id in the previous interaction." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0117 ; owl:annotatedTarget "binding region" . [] oboInOwl:hasDbXref "PMID:18706817" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1152 ; owl:annotatedTarget "This value quantifies the cooperative effect of an interaction on a subsequent interaction. It is the fold change of the affinity or a catalytic parameter of a molecule for one ligand in the absence, versus presence, of a second ligand or a post-translational modification." . [] oboInOwl:hasDbXref "PMID:18706817" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1153 ; owl:annotatedTarget "For an interaction that has a cooperative effect on a subsequent interaction, this term indicates whether this effect is positive or negative, i.e. whether the subsequent interaction is augmented or diminished." . [] oboInOwl:hasDbXref "PMID:18706817" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1154 ; owl:annotatedTarget "This term specifies that an interaction augments a subsequent interaction." . [] oboInOwl:hasDbXref "PMID:18706817" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1155 ; owl:annotatedTarget "This term specifies that an interaction diminishes a subsequent interaction." . [] oboInOwl:hasDbXref "PMID:18641616" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1156 ; owl:annotatedTarget "For an interaction that has a cooperative effect on a subsequent interaction, this term indicates the process that mediates this effect." . [] oboInOwl:hasDbXref "PMID:18641616", "PMID:18706817" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1157 ; owl:annotatedTarget "Reciprocal energetic coupling between two binding events at distinct sites on the same molecule. The first binding event alters the binding or catalytic properties of the molecule for the second binding event." . [] oboInOwl:hasDbXref "PMID:18641616" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1158 ; owl:annotatedTarget "A non-allosteric mechanism where the strength of an interaction depends on whether or not a particular molecular complex already exists." . [] oboInOwl:hasDbXref "PMID:18706817" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1159 ; owl:annotatedTarget "A molecule whose binding or catalytic properties at one site are altered by allosteric post-translational modification or binding of an allosteric effector at a distinct site. An allosteric molecule is identified by referring to its participant id." . [] oboInOwl:hasDbXref "PMID:18706817" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1160 ; owl:annotatedTarget "A ligand that elicits an allosteric response upon binding to a target molecule." . [] oboInOwl:hasDbXref "PMID:18706817" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1162 ; owl:annotatedTarget "An allosteric response in which the affinity of a molecule is altered." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0118 ; owl:annotatedTarget "A change in a sequence or structure in comparison to a reference entity due to a insertion, deletion or substitution event." . [] oboInOwl:hasDbXref "PMID:18706817" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1163 ; owl:annotatedTarget "An allosteric response in which catalysis (kcat or Vmax) of an enzyme is altered." . [] oboInOwl:hasDbXref "PMID:18706817" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1165 ; owl:annotatedTarget "The allosteric mechanism where changes in the local structure of an allosteric molecule result in altered binding or catalytic properties." . [] oboInOwl:hasDbXref "PMID:18706817" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1166 ; owl:annotatedTarget "The allosteric mechanism where changes in the local dynamics of an allosteric molecule result in altered binding or catalytic properties." . [] oboInOwl:hasDbXref "PMID:18706817" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1167 ; owl:annotatedTarget "This term indicates the chemical relationship between the two ligands whose binding is allosterically coupled." . [] oboInOwl:hasDbXref "PMID:18706817" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1168 ; owl:annotatedTarget "The type of allostery that occurs when the two ligands whose binding is allosterically coupled are not chemically identical." . [] oboInOwl:hasDbXref "PMID:18706817" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1169 ; owl:annotatedTarget "The type of allostery that occurs when the two ligands whose binding is allosterically coupled are chemically identical." . [] oboInOwl:hasDbXref "PMID:18641616" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1170 ; owl:annotatedTarget "This term describes the way in which preformation of a molecular complex has a non-allosteric cooperative effect on subsequent interactions of its components." . [] oboInOwl:hasDbXref "PMID:18641616" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1171 ; owl:annotatedTarget "The preformation of a complex results in the generation of a continuous binding site that spans more than one component of this complex. The functional binding site does not exist outside the context of the preformed complex." . [] oboInOwl:hasDbXref "PMID:22480932" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1172 ; owl:annotatedTarget "The addition of a PTM to an interaction interface affects the physicochemical compatibility of the binding site with its binding partner. This can either induce or enhance an interaction, or result in inhibition or even abrogation of an interaction. Multisite modification can mediate rheostatic regulation of the interaction." . [] oboInOwl:hasDbXref "PMID:22480932" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1173 ; owl:annotatedTarget "The occurrence of overlapping or adjacent, mutually exclusive binding sites promotes competitive binding. When there is a large difference in affinity of the different sites or in local abundance of competitors, binding at one site results in hiding of the second site, thereby precluding it from interacting when the hiding molecule is present." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0119 ; owl:annotatedTarget "Region of a molecule whose mutation or deletion decreases significantly interaction strength or rate (in the case of interactions inferred from enzymatic reaction)." . [] oboInOwl:hasDbXref "PMID:18641616" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1174 ; owl:annotatedTarget "Multivalent ligands form multiple discrete interactions with one or more binding partners. In some cases, An initial binding event can pre-organize other sites for binding. This reduces the degrees of freedom of these sites, thus reducing the entropic costs of their interactions. In addition, the combined strength of multiple interactions increases the enthalpic stability of each interaction (avidity effect). As a result of such effects, interactions of this kind can have a cooperative effect on subsequent interactions." . [] oboInOwl:hasDbXref "PMID:18706817" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1175 ; owl:annotatedTarget "A post-translational modification that elicits an allosteric response upon addition to a target molecule. An allosteric post-translational modification is identified by referring to its feature id." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1175 ; owl:annotatedTarget "allosteric ptm" . [] oboInOwl:hasDbXref "PMID:15131651" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1176 ; owl:annotatedTarget "Sequence analysis of the regulatory region of a gene used to predict specific elements, transcription factor binding sites (TFBS), where binding of specific transcription factors can occur." . [] oboInOwl:hasDbXref "PMID:12671656" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1177 ; owl:annotatedTarget "Sequence analysis based on multiple homologous alignments of the regulatory region of a gene used to predict specific elements, transcription factor binding sites (TFBS), where binding of specific transcription factors can occur. These methods often also use transcription factor binding motif models." . [] oboInOwl:hasDbXref "PMID:16381970" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1178 ; owl:annotatedTarget "Computational methods based on evolutionary hypothesis, used as criteria to browse sequences and predict a transcription factor using structural and sequence features of the protein, e.g., by evaluating if the potential transcription factor protein contains a DNA-binding domain that is known to bind to some regulatory elements, or prediction of transcription factor functional domains (DNA binding, transcription factor dimerization, etc.), all based on sequence or structural features of the transcription factor." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1179 ; owl:annotatedTarget "Identification of a part of a nucleotide sequence, usually then related to the full length sequence by alignment. Depending on the experimental design, nucleotide sequence can be determined before the interaction detection while building a collection of clones or after the selection of randomly generated clone.s" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1179 ; owl:annotatedTarget "partial nucleotide sequence" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1180 ; owl:annotatedTarget "Identification of a part of a DNA sequence, usually then related to the full length sequence by alignment. Depending on the experimental design, nucleotide sequence can be determined before the interaction detection while building a collection of clones or after the selection of randomly generated clones." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1180 ; owl:annotatedTarget "partial dna sequence" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0012 ; owl:annotatedTarget "BRET" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0119 ; owl:annotatedTarget "hotspot" . [] oboInOwl:hasDbXref "PMID:19339662" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1181 ; owl:annotatedTarget "Paired-end tags (PET) are the short sequences at the 5 prime and 3 prime ends of the DNA fragment of interest, which can be a piece of genomic DNA or cDNA." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1181 ; owl:annotatedTarget "paired end tags" . [] oboInOwl:hasDbXref "PMID:7685766" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1183 ; owl:annotatedTarget "Binding of a molecule to a strand of nucleic acid protects that region of nucleic acid from the action of a nuclease. The protected region can subsequently be sequenced and the binding site identified." . [] oboInOwl:hasDbXref "PMID:10748524" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1184 ; owl:annotatedTarget "DNA adenine methyltransferase identification is used to map the binding sites of DNA- and chromatin-binding proteins in eukaryotes. DamID identifies binding sites by expressing the proposed DNA-binding protein as a fusion protein with DNA methyltransferase. Binding of the protein of interest to DNA localizes the methyltransferase in the region of the binding site. Adenosine methylation does not occur naturally in eukaryotes and therefore adenine methylation in any region can be concluded to have been caused by the fusion protein, implying the region is located near a binding site." . [] oboInOwl:hasSynonymType mi:PSI-MOD-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1184 ; owl:annotatedTarget "DamID" . [] oboInOwl:hasDbXref "PMID:10748524" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1185 ; owl:annotatedTarget "Proteins of interest are tagged with Escherichia coli DNA adenine methyltransferase (dam). Expression of this fusion protein in vivo leads to preferential methylation of adenines in DNA surrounding the native binding sites of the dam fusion partner. Because adenine methylation does not occur endogenously in most eukaryotes, it provides a unique tag to mark protein interaction sites. The adenine-methylated DNA fragments are isolated by selective polymerase chain reaction amplification and can be identified by microarray hybridization." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1185 ; owl:annotatedTarget "tag DNA methyltransferase" . [] oboInOwl:hasDbXref "PMID:10748524" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1186 ; owl:annotatedTarget "The protein of interest is fused to Escherichia coli DNA adenine methyltransferase (dam). Expression of this fusion protein in vivo leads to preferential methylation of adenines in DNA surrounding the native binding sites of the dam fusion partner. Because adenine methylation does not occur endogenously in most eukaryotes, it provides a unique tag to mark protein interaction sites." . [] oboInOwl:hasDbXref "PMID:21472695" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1187 ; owl:annotatedTarget "A mutant form of DNA adenine methyltransferase (DamK9A) from E. coli is fused to the protein of interest and expressed. The fusion protein will bind to target binding sites and introduce N-6-adenine methylation in nearby sites in the genomic DNA. Methylated DNA fragments are enriched with an antibody against N-6-methyladenine and used for further analysis." . [] oboInOwl:hasDbXref "PMID:21720958" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1189 ; owl:annotatedTarget "In interference assays, the DNA will be methylated before the binding assay. Protein binding to DNA protects DNA from methylation by dimethylsulphate. If the contact points are methylated, the protein binding is prevented. After isolating the protein-DNA complex, the methylation sites are cleaved by chemical method. As a result, only those regions out of the binding sites will be cleaved. The protein binding region is not methylated; hence, this region is not cleaved. Although the pattern looks like a footprint, the blank region means \"contact points\"." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0119 ; owl:annotatedTarget "mutation decreasing" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1189 ; owl:annotatedTarget "methylation interference" . [] oboInOwl:hasDbXref "PMID:3090544" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1190 ; owl:annotatedTarget "Hydroxyl radicals are created from the Fenton reaction, which involves reducing Fe2+ with H2O2 to form free hydroxyl molecules. These hydroxyl molecules react with the DNA backbone, resulting in a break. Protein bound regions of the DNA are protected." . [] oboInOwl:hasDbXref "PMID:2842760", "PMID:6728031" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1191 ; owl:annotatedTarget "Ultraviolet irradiation excites nucleic acids and creates photoreactions, which results in damaged bases in the DNA strand. Protein bound regions of the DNA are protected. UV footprinting technique can detect sequence-specific protein-DNA interactions in vivo. Protein contacts can inhibit of enhance UV photoproduct formation by affecting the ability of DNA to adopt a geometry necessary for the formation of a UV photoproduct. Thus, differences in the strand-breakage patterns of protein-free and protein-bound DNA can be used to detect protein-DNA contacts." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1192 ; owl:annotatedTarget "This approach is based on the observation that a synthesized nucleic acid that is complementary to a specific mRNA can decrease the synthesis of its gene product either by increasing the degradation of the targeted mRNA or by interfering with its translation." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1193 ; owl:annotatedTarget "Identification of a part of a RNA sequence, usually then related to the full length sequence by alignment." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1193 ; owl:annotatedTarget "partial rna sequence" . [] oboInOwl:hasDbXref "PMID:12958470" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1194 ; owl:annotatedTarget "Reverse Transcription PCR (RT-PCR) is used for amplifying DNA from RNA. Reverse transcriptase reverse transcribes RNA into cDNA, which is then amplified by PCR." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1194 ; owl:annotatedTarget "RT-PCR" . [] oboInOwl:hasDbXref "PMID:12958470" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1195 ; owl:annotatedTarget "Quantitative PCR (Q-PCR) is used to measure the quantity of a PCR product (commonly in real-time). It quantitatively measures starting amounts of DNA, cDNA, or RNA." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1195 ; owl:annotatedTarget "q-pcr" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0120 ; owl:annotatedTarget """Residue covalent modifications occurring in the specific protein form involved in an interaction. OBSOLETE remap to MOD:00000.""" . [] oboInOwl:hasDbXref "PMID:12958470" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1196 ; owl:annotatedTarget "Technique used to measure the quantity of DNA amplified from RNA." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1196 ; owl:annotatedTarget "QRT-PCR" . [] oboInOwl:hasDbXref "PMID:13846364." ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1197 ; owl:annotatedTarget "To perform a radioimmunoassay, a known quantity of an antigen is made radioactive, frequently by labeling it with gamma-radioactive isotopes of iodine attached to tyrosine. This radiolabeled antigen is then mixed with a known amount of antibody for that antigen, and as a result, the two chemically bind to one another. Then, a sample containing an unknown quantity of that same antigen is added. This causes the unlabeled (or \"cold\") antigen from the serum to compete with the radiolabeled antigen (\"hot\") for antibody binding sites. As the concentration of \"cold\" antigen is increased, more of it binds to the antibody, displacing the radiolabeled variant, and reducing the ratio of antibody-bound radiolabeled antigen to free radiolabeled antigen. The bound antigens are then separated from the unbound ones, and the radioactivity of the free antigen remaining in the supernatant is measured." . [] oboInOwl:hasDbXref "PMID:16006601" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1198 ; owl:annotatedTarget "Method using an antibody coupled with some colouring agent to detect a specific protein within a tissue sample. In some cases the primary antibody is directly linked to a colouring agent, more often the primary antibody is targeted by a secondary antibody, targeting the primary antibody." . [] oboInOwl:hasDbXref "PMID:16006601" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1199 ; owl:annotatedTarget "Method using an antibody coupled with some colouring agent to detect a tag fused to a specific protein within a tissue sample. In some cases the primary antibody is directly linked to a colouring agent, more often the primary antibody is targeted by a secondary antibody, targeting the primary antibody." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1200 ; owl:annotatedTarget "Method using an antibody coupled with some colouring agent to detect a specific protein within a cell. In some cases the primary antibody is directly linked to a colouring agent, more often the primary antibody is targeted by a secondary antibody, targeting the primary antibody." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1201 ; owl:annotatedTarget "Method using an antibody coupled with some colouring agent to detect a specific tag fused to a protein within a cell. In some cases the primary antibody is directly linked to a colouring agent, more often the primary antibody is targeted by a secondary antibody, targeting the primary antibody." . [] oboInOwl:hasDbXref "PMID:19688738" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1202 ; owl:annotatedTarget "Synthetic peptide tag (SAWSHPQFEK-(GGGS)2-SAWSHPQFEK)" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1202 ; owl:annotatedTarget "twin-strep-tag" . [] oboInOwl:hasDbXref "PMID:20734273" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1203 ; owl:annotatedTarget "Two proteins of interest, a bait and prey, which are genetically fused to amino- and carboxy-terminal fragments of luciferase, are transiently expressed. Physical interactions of these bait and prey proteins reconstitute some of the luciferase activity and result in light emission in the presence of the luciferase substrate." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0120 ; owl:annotatedTarget "ptm" . [] oboInOwl:hasDbXref "PMID:20734273", "PMID:22070901" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1204 ; owl:annotatedTarget "Two proteins of interest, a bait and prey, which are genetically fused to amino- and carboxy-terminal fragments of firefly (Photinus pyralis) luciferase, are transiently expressed. Physical interactions of these bait and prey proteins reconstitute some of the luciferase activity and result in light emission in the presence of the luciferase substrate." . [] oboInOwl:hasDbXref "PMID:12705589" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1206 ; owl:annotatedTarget "The n-terminus of the renilla luciferase protein, fused to a protein of interest for use in the split luciferase complementation assay." . [] oboInOwl:hasDbXref "PMID:12705589" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1207 ; owl:annotatedTarget "The c-terminus of the renilla luciferase protein, fused to a protein of interest for use in the split luciferase complementation assay." . [] oboInOwl:hasDbXref "PMID:22070901" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1208 ; owl:annotatedTarget "Firefly luciferase, is an enzyme from beetles (Photinus pyralis) catalyzing the oxidation of the lucifering pigment (reaction with ATP or oxygen) that produces light. Firefly luciferase produces a greenish yellow light in the 550-570nm range." . [] oboInOwl:hasDbXref "PMID:22070901" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1209 ; owl:annotatedTarget "The c-terminus of the firefly luciferase protein, fused to a protein of interest for use in the split luciferase complementation assay." . [] oboInOwl:hasDbXref "PMID:22070901" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1210 ; owl:annotatedTarget "The n-terminus of the firefly luciferase protein, fused to a protein of interest for use in the split luciferase complementation assay." . [] oboInOwl:hasDbXref "PMID:14734570" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1211 ; owl:annotatedTarget "Lipid binding proteins incubated with liposomes of known lipid content. Mixture is then centrifuged and proteins bound to liposomes separated out." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1212 ; owl:annotatedTarget "A fixed-size datum calculated (by using a hash function) for a molecular sequence or structure, typically for purposes of error detection or indexing." . [] oboInOwl:hasDbXref "PMID:22229727" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1213 ; owl:annotatedTarget "N-terminal region of the Venus fusion protein, created by the introduction of a point mutation into Aequorea-derived YFP, the substitution of leucine for phenylalanine at position 46 (F46L). This tag is used for split flurescence complementation assays." . [] oboInOwl:hasDbXref "PMID:22229727" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1214 ; owl:annotatedTarget "C-terminal region of the Venus fusion protein, created by the introduction of a point mutation into Aequorea-derived YFP, the substitution of leucine for phenylalanine at position 46 (F46L). This tag is used for split flurescence complementation assays." . [] oboInOwl:hasDbXref "PMID:11125103" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0121 ; owl:annotatedTarget """Residue modification. OBSOLETE remap to MOD:00394.""" . [] oboInOwl:hasDbXref "PMID:17406412" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1215 ; owl:annotatedTarget "Fusion protein which consists of either the N- or C-terminal sequence of a fluorescent or luciferase protein. Binding of the proteins of interest enable the reassembly of the molecule, indicating that an interaction has occured." . [] oboInOwl:hasDbXref "PMID:17406412" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1216 ; owl:annotatedTarget "c-terminal fragment of green fluorescent protein used as a tag in bimolecular fluorescence complementation (BiFC)." . [] oboInOwl:hasDbXref "PMID:17406412" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1217 ; owl:annotatedTarget "n-terminal fragment of green fluorescent protein used as a tag in bimolecular fluorescence complementation (BiFC)." . [] oboInOwl:hasDbXref "PMID:11847345" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1218 ; owl:annotatedTarget "Chromosome conformation capture,[1] or 3C, is a high-throughput molecular biology technique used to analyze the organization of chromosomes in a cell's natural state. The basic 3C technique consists of cross-linking by addition of formaldehyde followed by addition of a restriction enzyme in excess to the cross-linked DNA, separating the non-cross-linked DNA from the cross-linked chromatin. A intramolecular ligation step using very low concentrations of DNA favors the ligation of relevant DNA fragments with the corresponding junctions instead of the ligation of random fragments. There are two major types of ligation junctions that are over-represented. One is the junction that forms between neighboring DNA fragments due to incomplete digestion, which represents about 20-30% of all junctions. This number is decreased by reducing the cross-linking stringency in the first step. The other type of junctions over-represented in this technique is the junction that forms when one end of the fragment ligates with the other end of the same fragment, and contributes up to 30% of all junctions formed. High temperature then results in the reversal of the previously formed cross-links. The resulting linear DNA fragment has specific restriction ends as well as a central restriction site corresponding to the site of ligation. The pool of these fragments is collectively referred to as the 3C library." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1218 ; owl:annotatedTarget "chip-3c" . [] oboInOwl:hasDbXref "PMID:21214558" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1219 ; owl:annotatedTarget "Enzyme-mediated activation of radical sources is used to identify partners of a given molecule on the cell surface in living cells Activation of the cross-linking reagent arylazide-biotin tag is accomplished by an enzyme, horseradish peroxidase is featured by radical formation of the labelling reagent by horseradish peroxidase (HRP)." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1219 ; owl:annotatedTarget "emars" . [] oboInOwl:hasDbXref "PMID:20609414" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1220 ; owl:annotatedTarget "The protein is expressed as a hybrid protein fused to a tag containing a luciferase activity. Subsequence observation or measurement of luciferase activity is used to identify the presence of the molecule in an interaction." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1220 ; owl:annotatedTarget "tag luciferase" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1221 ; owl:annotatedTarget "A score generated by an author, usually only relevant for that particular dataset." . [] oboInOwl:hasDbXref "PMID:11125103", "RESID:AA0041" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0122 ; owl:annotatedTarget """Residue modification. OBSOLETE remap to MOD:00050.""" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1221 ; owl:annotatedTarget "author score" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1222 ; owl:annotatedTarget "MBInfo is a wiki based, multimedia, educational resource providing up to date reviews on topics relating to mechanobiology (http://www.mechanobio.info/)." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1222 ; owl:annotatedTarget "MBInfo" . [] oboInOwl:hasDbXref "PMID:14744292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1223 ; owl:annotatedTarget "Post translational modification on a protein observed to decrease the strength or rate of an interaction." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1223 ; owl:annotatedTarget "decreasing-ptm" . [] oboInOwl:hasDbXref "PMID:14744292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1224 ; owl:annotatedTarget "Post translational modification on a protein observed to increase the strength or rate of an interaction." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1224 ; owl:annotatedTarget "increasing-ptm" . [] oboInOwl:hasDbXref "PMID:14744292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1225 ; owl:annotatedTarget "Post translational modification on a protein observed to disrupt the strength or rate of an interaction." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1225 ; owl:annotatedTarget "disrupting-ptm" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1226 ; owl:annotatedTarget "Formation of phosphodiester or phosphoramide ester of AMP on Tyr (RESID:AA0203), Lys (RESID:AA0227), Thr (RESID:AA0267), His (RESID:AA0371) and other amino acids" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0122 ; owl:annotatedTarget "(S)-2-(acetylamino)propanoic acid" . [] oboInOwl:hasDbXref "PMID:15644491" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1227 ; owl:annotatedTarget "Tag encoding green fluorescent protein (GFP) , a TEV cleavage site, and a second purification tag such as S peptide or 6xHis. The tag can therefore be used for both localisation and affinity purification." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1227 ; owl:annotatedTarget "lap tag" . [] oboInOwl:hasDbXref "PMID:9371754" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1228 ; owl:annotatedTarget "A polyoma virus-derived (Pyo) epitope tag (amino acids MEYMPME)." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1229 ; owl:annotatedTarget "Measures the formation of a phosphodiester or phosphoramide ester of UMP and an amino acid (MOD:01166)." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1230 ; owl:annotatedTarget "The formation of a phosphodiester or phosphoramide ester of UMP and amino acid (MOD:01166)." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1230 ; owl:annotatedTarget "uridylation" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1231 ; owl:annotatedTarget "AMC (aminomethylcoumarin ) is a blue fluorescent tag with reactive derivatives that are used as contrasting probes for double- and triple-labeling in immunofluorescence microscopy, arrays and in situ hybridization and can be attached to proteins or small molecules for reaction monitoring." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1231 ; owl:annotatedTarget "AMC label" . [] oboInOwl:hasDbXref "PMID:22179788" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1232 ; owl:annotatedTarget "An interaction between two proteins is inferred from monitoring the effect of the presence of one of them on the aggregation state of the second." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1232 ; owl:annotatedTarget "aggregation" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0122 ; owl:annotatedTarget "AAC" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1233 ; owl:annotatedTarget "The cleavage which results due to the action of a proteolytic enzyme on its substrate." . [] oboInOwl:hasDbXref "PMID:17139335", "PMID:18369856" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1234 ; owl:annotatedTarget "SILAC (Stable Isotope Labeling by Amino acids in Cell culture) can be used to detect features (typically PTMs) required for a given interaction." . [] oboInOwl:hasDbXref "PMID:22052482" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1235 ; owl:annotatedTarget "Ligand binding to a target protein can stabilize a protein's native state, as shown in the increase of the bound protein's melting temperature. The midpoint of the melting curve of a protein will increase in the presence of ligands that bind more tightly to the native state than the unfolded state." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1235 ; owl:annotatedTarget "thermal shift" . [] oboInOwl:hasDbXref "PMID:9344417" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1236 ; owl:annotatedTarget "Measurment of the conversion between cis- and trans- peptide bonds formed by the amine group of a proline. Peptide bonds to proline, and to other N-substituted amino acids (such as sarcosine), are able to populate both the cis and trans isomers the cis and trans isomers of the X-Pro peptide bond (where X represents any amino acid) both experience steric clashes with the neighboring substitution and are nearly equal energetically. Hence, the fraction of X-Pro peptide bonds in the cis isomer under unstrained conditions ranges from 10-40%; the fraction depends slightly on the preceding amino acid, with aromatic residues favoring the cis isomer slightly." . [] oboInOwl:hasDbXref "PMID:9344417" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1237 ; owl:annotatedTarget "The conversion between cis- and trans- peptide bonds formed by the amine group of a proline." . [] oboInOwl:hasDbXref "PMID:20351246" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1238 ; owl:annotatedTarget "Heavy/light isotope-labelled subunits are prepared and allowed to form their respective mature oligomeric structure. Oligomers are then mixed and subunit exchange is monitored, usually by electrospray ionisation-ion mobility spectrometry-mass spectrometry." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1238 ; owl:annotatedTarget "ms subunit exchange" . [] oboInOwl:hasDbXref "PMID:18175334" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1239 ; owl:annotatedTarget "A naturally-occuring amino-acid variation to the reference sequence, including polymorphisms, variations between strains, isolates or cultivars, disease-associated mutations and RNA editing events." . [] oboInOwl:hasDbXref "PMID:18175334" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1240 ; owl:annotatedTarget "A naturally-occuring amino-acid variation to the reference sequence which results in the organism developing, or becoming susceptible to a particular disease condition." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0122 ; owl:annotatedTarget "N-acetyl-L-alanine" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1240 ; owl:annotatedTarget "disease aa variant" . [] oboInOwl:hasDbXref "PMID:11757069" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1242 ; owl:annotatedTarget "A fusion protein tag consisting of a portion of the constant region of IgG1." . [] oboInOwl:hasDbXref "PMID:11757069" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1243 ; owl:annotatedTarget "A fusion protein tag consisting of a portion of the constant region of IgG2." . [] oboInOwl:hasDbXref "PMID:17721542" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1244 ; owl:annotatedTarget "Monomeric far-red fluorescent protein generated from the wild-type RFP from sea anemone Entacmaea quadricolor. It possesses bright fluorescence with excitation/emission maxima at 588 and 635 nm, respectively." . [] oboInOwl:hasDbXref "PMID:17721542" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1245 ; owl:annotatedTarget "Monomeric far-red fluorescent protein generated from the wild-type RFP from sea anemone Entacmaea quadricolor. It possesses bright fluorescence with excitation/emission maxima at 588 and 635 nm, respectively." . [] oboInOwl:hasDbXref "PMID:18600219" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1246 ; owl:annotatedTarget "IM-MS analysis is performed by first ionizing the protein complex of interest followed by ion mobility separation according to their cross-section-to-charge (Q/z) ratio. After separation, ions are sampled by a mass spectrometer and analyzed according to their mass-to-charge (m/z) ratio. Combined knowledge of both Q/z and m/z can be used to infer the size and shape of the complex." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1246 ; owl:annotatedTarget "ion mobility mass spec" . [] oboInOwl:hasDbXref "PMID:17164337" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1247 ; owl:annotatedTarget "Measurement of the directed movement of particles in a microscopic temperature gradient. Any change of the hydration shell of biomolecules due to changes in their structure/conformation results in a relative change of movement along the temperature gradient and is used to determine binding affinities, binding kinetics and activity kinetics. Events such as the phosphorylation of a protein or the binding of small molecules to a target can be monitored." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1247 ; owl:annotatedTarget "mst" . [] oboInOwl:hasDbXref "PMID:19067126" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1248 ; owl:annotatedTarget "Composed of dipyrromethene complexed with a disubstituted boron atom, typically a BF2 unit. Notable for their uniquely small Stokes shift, high, environment-independent fluorescence quantum yields." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0122 ; owl:annotatedTarget "[A:ac]" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1249 ; owl:annotatedTarget "Measurement of the catalysis of the structural rearrangement of isomers." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1250 ; owl:annotatedTarget "The catalysis of the structural rearrangement of isomers." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1251 ; owl:annotatedTarget "The catalysis of the conversion of methylmalonyl-CoA to succinyl-CoA by transfer of the carbonyl group. It requires a cobamide coenzyme. EC 5.4.99.2." . [] oboInOwl:hasDbXref "PMID:147292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1252 ; owl:annotatedTarget "The catalysis othe conversion of methylmalonyl-CoA to succinyl-CoA by transfer of the carbonyl group. It requires a cobamide coenzyme. EC 5.4.99.2" . [] oboInOwl:hasDbXref "PMID:14760721" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1253 ; owl:annotatedTarget "Fluorescent tag - maleimide couples to thiols." . [] oboInOwl:hasDbXref "PMID:14760721" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1254 ; owl:annotatedTarget "Fluorescent tag - maleimide couples to thiols." . [] oboInOwl:hasDbXref "PMID:16287229" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1255 ; owl:annotatedTarget "1,2-Diphenylethene" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1256 ; owl:annotatedTarget "Luminescent dyes such as cyanines,commonly used for DNA labelling." . [] oboInOwl:hasDbXref "PMID:12622145" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1257 ; owl:annotatedTarget "Rhodamines are supplements to fluoresceins, as they offer longer wavelength emission maxima and provide opportunities for multicolor labeling or staining." . [] oboInOwl:hasDbXref "PMID:12622145" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1258 ; owl:annotatedTarget "Tetramethyl rhodamine - a derivative of rhodamine." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0012 ; owl:annotatedTarget "LRET" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0122 ; owl:annotatedTarget "acetylalanine" . [] oboInOwl:hasDbXref "PMID:12622145" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1259 ; owl:annotatedTarget "The thiol reactive acrylodan (6-acryloyl-2-dimethylaminonaphthalene) generally reacts with thiols more slowly than iodoacetamides or maleimides, but does form very strong thioether bonds that are expected to remain stable under conditions required for complete amino acid analysis. The fluorescence emission peak and intensity of these adducts are particularly sensitive to conformational changes or ligand binding." . [] oboInOwl:hasDbXref "PMID:12622145" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1260 ; owl:annotatedTarget "Pyrene is a polycyclic aromatic hydrocarbon (PAH) consisting of four fused benzene rings, resulting in a flat aromatic system. The chemical formula is C16H10. Its derivatives are valuable molecular probes via fluorescence spectroscopy, having a high quantum yield and lifetime." . [] oboInOwl:hasDbXref "PMID:12622145" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1261 ; owl:annotatedTarget "Oregon Green 488 and Oregon Green 514 dyes are fluorinated analogs of fluoresceins" . [] oboInOwl:hasDbXref "PMID:19850753" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1262 ; owl:annotatedTarget "Interologous Interaction Database is an on-line database of known and predicted mammalian and eukaryotic protein-protein interactions." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1262 ; owl:annotatedTarget "I2D" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1262 ; owl:annotatedTarget "IID" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1262 ; owl:annotatedTarget "Interologous Interaction Database" . [] oboInOwl:hasDbXref "PMID:22453911" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1263 ; owl:annotatedTarget "Molecular Connections Private Limited is an in silico discovery Services Company with expertise in drug-discovery, informatics and information technology. They perform pro bono work for the IMEx Consortium. http://www.molecularconnections.com" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1263 ; owl:annotatedTarget "Molecular Connections" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1264 ; owl:annotatedTarget "Norwegian University of Science and Technology. www.ntnu.no/home." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0122 ; owl:annotatedTarget "acetylalanine" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1264 ; owl:annotatedTarget "NTNU" . [] oboInOwl:hasDbXref "PMID:9560251" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1265 ; owl:annotatedTarget "In the split-ubiquitin system, two integral membrane proteins to be studied are fused to two different ubiquitin moieties: a C-terminal ubiquitin moiety (residues 35-76) and an N-terminal ubiquitin moiety (residues 1-34). These fused proteins are called the bait and prey, respectively. In addition to being fused to an integral membrane protein, the Cub moiety is also fused to a transcription factor that can be cleaved off by ubiquitin specific proteases." . [] oboInOwl:hasDbXref "PMID:9560251" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1266 ; owl:annotatedTarget "A C-terminal ubiquitin moiety (cub, residues 35-76) plus a transcription factor that can be cleaved off by ubiquitin specific proteases. Regarded as attached to the bait molecules in ubiquitin reconstruction assays." . [] oboInOwl:hasDbXref "PMID:9560251" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1267 ; owl:annotatedTarget "N-terminal ubiquitin moiety (nub, residues 1-34)." . [] oboInOwl:hasDbXref "PMID:9560251" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1268 ; owl:annotatedTarget "N-terminal ubiquitin moiety (residues 1-34) containing a Ile13Gly mutation." . [] oboInOwl:hasDbXref "PMID:21051339" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1269 ; owl:annotatedTarget "An identical protein sequence is coded for by the multiple genes within the same organism. These proteins may previously be merged into a single entry by UniProt and subsequently demerged." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1270 ; owl:annotatedTarget "Contains a polyhistidine sequence, the Xpress epitope (part of bacteriophage T7 gene 10 protein) and an enterokinase cleavage site. Anti-Xpress antibodies recognise the Xpress epitope sequence found in this leader peptide. Asp-Leu-Tyr-Asp-Asp-Asp-Asp-Lys." . [] oboInOwl:hasDbXref "PMID:15833125" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1271 ; owl:annotatedTarget """An effect in which the phenotype of one genetic perturbation is enhanced by a second perturbation to a severity/penetrance beyond (further from wild type) that expected by the superimposition or addition of effects of the individual perturbations. With respect to any single quantifiable phenotype, this may be expressed as an inequality as: ab < E < wt OR wt < E < ab where 'ab' is the observed phenotype value of the double perturbation, 'E' is the expected phenotype value of the double perturbation, and 'wt' is the wild type phenotype value.""" . [] oboInOwl:hasDbXref "PMID:15833125" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1272 ; owl:annotatedTarget """An effect in which individual perturbations of two different genes result in different mutant phenotypes (which are traits measured on the same quantitative scale but each significantly deviating, in the same direction, from wild type), and the resulting phenotype of their combination is equal to that of only one of the perturbations. With respect to any single quantifiable phenotype, this may be expressed as an inequality as: ((a* < b < wt) OR (wt < b < a*)) AND (ab = a OR ab = b) where 'a' and 'b' are the observed phenotype values of the individual perturbations ('a*' being the most severe of the two), 'ab' is the observed phenotype value of the double perturbation, and 'wt' is the wild type phenotype value.""" . [] oboInOwl:hasDbXref "PMID:15833125" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1273 ; owl:annotatedTarget """An effect in which individual perturbations of two different genes result in the same mutant phenotype to varying degrees of severity/penetrance and the resulting phenotype of their combination is equal in severity/penetrance to the most severe/penetrant of the individual perturbations. With respect to any single quantifiable phenotype, this may be expressed as an inequality as: ab = a* < b < wt OR wt < b < a* = ab where 'a' and 'b' are the observed phenotype values of the individual perturbations ('a*' being the most severe of the two), 'ab' is the observed phenotype value of the double perturbation, and 'wt' is the wild type phenotype value.""" . [] oboInOwl:hasDbXref "PMID:11125103", "RESID:AA0354" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0123 ; owl:annotatedTarget """Residue modification. OBSOLETE remap to MOD:00359.""" . [] oboInOwl:hasDbXref "PMID:15833125" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1274 ; owl:annotatedTarget """An effect in which individual perturbations of two different genes result in the same mutant phenotype to varying degrees of severity/penetrance and the resulting phenotype of their combination is equal in severity/penetrance to the least severe/penetrant of the individual perturbations. With respect to any single quantifiable phenotype, this may be expressed as an inequality as: a* < ab = b < wt OR wt < b = ab < a* where 'a' and 'b' are the observed phenotype values of the individual perturbations ('a*' being the most severe of the two), 'ab' is the observed phenotype value of the double perturbation, and 'wt' is the wild type phenotype value.""" . [] oboInOwl:hasDbXref "PMID:15833125" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1275 ; owl:annotatedTarget """OBSOLETE: An effect in which individual perturbations of two different genes result in different mutant phenotypes (which are EITHER traits measured on the same quantitative scale but each significantly deviating, in opposite directions, from wild type, OR completely (qualitatively) different phenotypes), and the resulting phenotype of their combination is equal to that of only one of the perturbations. With respect to any single quantifiable phenotype, this may be expressed as an inequality as: (a < wt < b) AND (ab = a OR ab = b) OR (a != wt AND b != wt AND a != b) AND (ab = a OR ab = b) where 'a' and 'b' are the observed phenotype values of the individual perturbations, 'ab' is the observed phenotype value of the double perturbation, 'wt' is the wild type phenotype value, and 'a != b' indicates qualitatively different phenotypes.""" . [] oboInOwl:hasDbXref "PMID:15833125" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1276 ; owl:annotatedTarget """An effect in which individual perturbations of two different genes result in opposite mutant phenotypes (traits measured on the same scale but each on opposing sides relative to the wild type phenotype), and the resulting phenotype of their combination is equal to that of only one of the perturbations. With respect to any single quantifiable phenotype, this may be expressed as an inequality as: (a < wt < b) AND (ab = a OR ab = b) where 'a' and 'b' are the observed phenotype values of the individual perturbations, 'ab' is the observed phenotype value of the double perturbation, and 'wt' is the wild type phenotype value.""" . [] oboInOwl:hasDbXref "PMID:15833125" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1277 ; owl:annotatedTarget """An effect in which individual perturbations of two different genes result in different mutant phenotypes (which are traits that cannot be measured on the same scale and, hence, qualitatively different), and the resulting phenotype of their combination is equal to that of only one of the perturbations. This may be expressed as an inequality as: (a != wt AND b != wt AND a != b) AND (ab = a OR ab = b) where 'a' and 'b' are the observed phenotypes of the individual perturbations, 'ab' is the observed phenotype of the double perturbation, 'wt' is the wild type phenotype and 'a != b' indicates qualitatively different phenotypes.""" . [] oboInOwl:hasDbXref "PMID:15833125" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1278 ; owl:annotatedTarget """An effect in which individual perturbations of different genes result in the same mutant phenotype (but, perhaps, to varying degrees of severity/penetrance) and the resulting phenotype of their combination is more severe/penetrant (further from wild type) than expected by the superimposition or addition of effects of the individual perturbations. With respect to any single quantifiable phenotype, this may be expressed as an inequality as: ab < a* <= b < wt [E = a*] OR wt < b <= a* < ab [E = a*] where 'a' and 'b' are the observed phenotype values of the individual perturbations ('a*' being the most severe of the two), 'ab' is the observed phenotype value of the double perturbation, 'E' is the expected phenotype value of the double perturbation, and 'wt' is the wild type phenotype value.""" . [] oboInOwl:hasDbXref "PMID:15833125" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1279 ; owl:annotatedTarget """An effect in which the phenotype of one genetic perturbation is enhanced by a second perturbation (which, on its own, has no effect on the phenotype in question) to a severity/penetrance beyond (further from wild type) that of the original phenotype. With respect to any single quantifiable phenotype, this may be expressed as an inequality as: ab < a < b = wt [E = a] OR wt = b < a < ab [E = a] where 'a' and 'b' are the observed phenotype values of the individual perturbations, 'ab' is the observed phenotype value of the double perturbation, 'E' is the expected phenotype value of the double perturbation, and 'wt' is the wild type phenotype value.""" . [] oboInOwl:hasDbXref "PMID:15833125" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1280 ; owl:annotatedTarget """An effect in which individual perturbations of different genes result in the same mutant phenotype (but, perhaps, to varying degrees of severity/penetrance) and the resulting phenotype of their combination is less severe/penetrant than expected from the original phenotypes. With respect to any single quantifiable phenotype, this may be expressed as an inequality as: (a* <= b < wt) AND (a* < ab <= wt) [E = a*] OR (wt < b <= a*) AND (wt <= ab < a*) [E = a*] where 'a' and 'b' are the observed phenotype values of the individual perturbations ('a*' being the most severe of the two), 'ab' is the observed phenotype value of the double perturbation, 'E' is the expected phenotype value of the double perturbation, and 'wt' is the wild type phenotype value.""" . [] oboInOwl:hasDbXref "PMID:15833125" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1281 ; owl:annotatedTarget """An effect in which individual perturbations of different genes result in the same mutant phenotype (but, perhaps, to varying degrees of severity/penetrance) and the resulting combination is wild type. With respect to any single quantifiable phenotype, this may be expressed as an inequality as: a* <= b < ab = wt OR wt = ab < b <= a* OR a < wt = ab < b where 'a' and 'b' are the observed phenotype values of the individual perturbations ('a*' being the most severe of the two), 'ab' is the observed phenotype value of the double perturbation, and 'wt' is the wild type phenotype value.""" . [] oboInOwl:hasDbXref "PMID:15833125" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1282 ; owl:annotatedTarget """An effect in which individual perturbations of different genes result in the same mutant phenotype (but, perhaps, to varying degrees of severity/penetrance) and the resulting phenotype of their combination is less severe/penetrant than expected, but not wild type. With respect to any single quantifiable phenotype, this may be expressed as an inequality as: (a* <= b < wt) AND (a* < ab < wt) [E = a*] OR (wt < b <= a*) AND (wt < ab < a*) [E = a*] where 'a' and 'b' are the observed phenotype values of the individual perturbations ('a*' being the most severe of the two), 'ab' is the observed phenotype value of the double perturbation, 'E' is the expected phenotype value of the double perturbation, and 'wt' is the wild type phenotype value.""" . [] oboInOwl:hasDbXref "PMID:15833125" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1283 ; owl:annotatedTarget """An effect in which individual perturbations of different genes result in the same mutant phenotype to varying degrees of severity/penetrance and the resulting phenotype of their combination has a phenotype more severe/penetrant than the least severe/penetrant and less severe/penetrant than the most severe/penetrant of the individual perturbations. With respect to any single quantifiable phenotype, this may be expressed as an inequality as: a* < ab < b < wt [E = a*] OR wt < b < ab < a* [E = a*] where 'a' and 'b' are the observed phenotype values of the individual perturbations ('a*' being the most severe of the two), 'ab' is the observed phenotype value of the double perturbation, 'E' is the expected phenotype value of the double perturbation, and 'wt' is the wild type phenotype value.""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0123 ; owl:annotatedTarget "N2-acetyl-L-arginine" . [] oboInOwl:hasDbXref "PMID:15833125" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1284 ; owl:annotatedTarget """An effect in which individual perturbations of two different genes result in different mutant phenotypes (which are traits measured on the same quantitative scale but each significantly deviating, in any direction, from wild type), and the resulting phenotype of their combination is equal to that of only one of the perturbations. With respect to any single quantifiable phenotype, this may be expressed as an inequality as: (a != wt AND b != wt AND a != b) AND (ab = a OR ab = b) where 'a' and 'b' are the observed phenotype values of the individual perturbations, 'ab' is the observed phenotype value of the double perturbation, 'wt' is the wild type phenotype value and 'a != b' indicates quantitatively different phenotypes.""" . [] oboInOwl:hasDbXref "PMID:15833125" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1285 ; owl:annotatedTarget """OBSOLETE: An effect in which individual perturbations of two different genes result in opposite mutant phenotypes (traits measured on the same scale but each on opposing sides relative to the wild type phenotype), and the resulting phenotype of their combination is equal to that of only one of the perturbations. With respect to any single quantifiable phenotype, this may be expressed as an inequality as: (a < wt < b) AND (ab = a OR ab = b) where 'a' and 'b' are the observed phenotype values of the individual perturbations, 'ab' is the observed phenotype value of the double perturbation, and 'wt' is the wild type phenotype value.""" . [] oboInOwl:hasDbXref "PMID:15833125" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1286 ; owl:annotatedTarget """An effect in which the observed phenotype of a double perturbation is opposite (relative to the wild type phenotype) to that which is expected upon the double perturbation. With respect to any single quantifiable phenotype, this may be expressed as an inequality as: ab < wt < E OR E < wt < ab where 'ab' is the observed phenotype value of the double perturbation, 'E' is the expected phenotype value of the double perturbation, and 'wt' is the wild type phenotype value.""" . [] oboInOwl:hasDbXref "PMID:15833125" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1287 ; owl:annotatedTarget """An effect in which individual perturbations of different genes result in the same mutant phenotype (but, perhaps, to varying degrees of severity/penetrance) and the resulting phenotype of their combination is opposite (relative to wild type) to that expected from the original phenotypes. With respect to any single quantifiable phenotype, this may be expressed as an inequality as: a* <= b < wt < ab [E = a*] OR ab < wt < b <= a* [E = a*] where 'a' and 'b' are the observed phenotype values of the individual perturbations ('a*' being the most severe of the two), 'ab' is the observed phenotype value of the double perturbation, 'E' is the expected phenotype value of the double perturbation, and 'wt' is the wild type phenotype value.""" . [] oboInOwl:hasDbXref "PMID:15833125" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1288 ; owl:annotatedTarget """An effect in which two individual perturbations result in opposite mutant phenotypes (relative to wild type) and their combination results in a phenotype that is more severe than the phenotype observed with the same directionality. With respect to any single quantifiable phenotype, this may be expressed as an inequality as: a < wt < b < ab OR ab < a < wt < b where 'a' and 'b' are the observed phenotype values of the individual perturbations, 'ab' is the observed phenotype value of the double perturbation, and 'wt' is the wild type phenotype value.""" . [] oboInOwl:hasDbXref "PMID:15833125" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1289 ; owl:annotatedTarget """OBSOLETE: An effect when two individual perturbations result in opposite mutant phenotypes (relative to wild type) and their combination results in a phenotype that is intermediate to the individual mutant phenotypes, but greater or less than wild type. With respect to any single quantifiable phenotype, this may be expressed as an inequality as: (a < wt < b) AND (a < ab < b) AND (ab != wt) where 'a' and 'b' are the observed phenotype values of the individual perturbations, 'ab' is the observed phenotype value of the double perturbation, and 'wt' is the wild type phenotype value.""" . [] oboInOwl:hasDbXref "PMID:15833125" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1290 ; owl:annotatedTarget """An effect in which the perturbation of one gene results in complete suppression (to wild type) of the mutant phenotype caused by perturbation of another gene. The phenotype of the suppressing perturbation may or may not be known. With respect to any single quantifiable phenotype, this may be expressed as an inequality as: wt = ab != a = E where 'a' is the observed phenotype values of an individual perturbation, 'ab' is the observed phenotype value of the double perturbation, 'E' is the expected phenotype value of the double perturbation, and 'wt' is the wild type phenotype value.""" . [] oboInOwl:hasDbXref "PMID:15833125" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1291 ; owl:annotatedTarget """An effect in which the perturbation of one gene results in the amelioration or lessening of the severity/penetrance of a mutant phenotype caused by perturbation of another gene, in effect making the organism more, but not completely, \"wild type\" in character with regards to the phenotype in question. The phenotype of the suppressing perturbation may or may not be known. With respect to any single quantifiable phenotype, this may be expressed as an inequality as: a* < ab < wt [E = a*] OR wt < ab < a* [E = a*] where 'a' and 'b' are the observed phenotype values of the individual perturbations ('a*' being the most severe of the two), 'ab' is the observed phenotype value of the double perturbation, 'E' is the expected phenotype value of the double perturbation, and 'wt' is the wild type phenotype value.""" . [] oboInOwl:hasDbXref "PMID:15833125" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1292 ; owl:annotatedTarget """An effect in which the perturbation of one gene, which has no effect on the phenotype in question, is combined with the perturbation of another gene, which causes the mutant phenotype in question, and results in the amelioration or lessening of the severity/penetrance of the mutant phenotype, in effect making the organism more \"wild type\" in character with regards to the phenotype in question. With respect to any single quantifiable phenotype, this may be expressed as an inequality as: a < ab <= b = wt [E = a] OR wt = b <= ab < a [E = a] where 'a' and 'b' are the observed phenotype values of the individual perturbations, 'ab' is the observed phenotype value of the double perturbation, 'E' is the expected phenotype value of the double perturbation, and 'wt' is the wild type phenotype value.""" . [] oboInOwl:hasDbXref "PMID:15833125" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1293 ; owl:annotatedTarget """An effect in which the perturbation of one gene, which has no effect on the phenotype in question, is combined with the perturbation of another gene, which causes the mutant phenotype in question, and results in the complete suppression (to wild type) of the mutant phenotype. With respect to any single quantifiable phenotype, this may be expressed as an inequality as: a < ab = b = wt [E = a] OR wt = b = ab < a [E = a] where 'a' and 'b' are the observed phenotype values of the individual perturbations, 'ab' is the observed phenotype value of the double perturbation, 'E' is the expected phenotype value of the double perturbation, and 'wt' is the wild type phenotype value.""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0123 ; owl:annotatedTarget "RAC" . [] oboInOwl:hasDbXref "PMID:15833125" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1294 ; owl:annotatedTarget """An effect in which the perturbation of one gene, which has no effect on the phenotype in question, is combined with the perturbation of another gene, which causes the mutant phenotype in question, and results in the amelioration or lessening of the severity/penetrance of the mutant phenotype, in effect making the organism more, but not completely, \"wild type\" in character with regards to the phenotype in question. With respect to any single quantifiable phenotype, this may be expressed as an inequality as: a < ab < b = wt [E = a] OR wt = b < ab < a [E = a] where 'a' and 'b' are the observed phenotype values of the individual perturbations, 'ab' is the observed phenotype value of the double perturbation, 'E' is the expected phenotype value of the double perturbation, and 'wt' is the wild type phenotype value.""" . [] oboInOwl:hasDbXref "PMID:15833125" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1295 ; owl:annotatedTarget """An effect in which the perturbation of one gene (which has no individual effect on the phenotype in question), when combined with a perturbation of another gene (which causes the phenotype in question), results in a mutant phenotype opposite (relative to wild type) to that of the original phenotype. With respect to any single quantifiable phenotype, this may be expressed as an inequality as: E = a < b = wt < ab OR ab < wt = b < a = E where 'a' and 'b' are the observed phenotype values of the individual perturbations, 'ab' is the observed phenotype value of the double perturbation, 'E' is the expected phenotype value of the double perturbation, and 'wt' is the wild type phenotype value.""" . [] oboInOwl:hasDbXref "PMID:19072539" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1296 ; owl:annotatedTarget "The presence of particular residues,for example those altered through post-translational modification, can be identified by amino acid analysis. Popular techniques for this include mass spectrometry or residue-specific antibodies." . [] oboInOwl:hasDbXref "PMID:19072539" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1297 ; owl:annotatedTarget "The presence of amino acid residues phosphorylated as a result of post-translational modification, can be identified by amino acid analysis. Popular techniques for this include mass spectrometry or residue-specific antibodies." . [] oboInOwl:hasDbXref "PMID:12853463" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1298 ; owl:annotatedTarget "A classification of the structural characteristics of a macromolecular complex." . [] oboInOwl:hasDbXref "PMID:12853464" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1299 ; owl:annotatedTarget "A description of the molecule types of which a macromolecular complex is composed." . [] oboInOwl:hasDbXref "PMID:12853463" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1300 ; owl:annotatedTarget "The protein chains present in the complex are not found as independent stable structures in vivo." . [] oboInOwl:hasDbXref "PMID:12853463" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1301 ; owl:annotatedTarget "Protein chains present in the complex may also be found as independent stable proteins in vivo." . [] oboInOwl:hasDbXref "PMID:12853464" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1302 ; owl:annotatedTarget "A stable set (2 or more) of interacting molecules which can be co-purified and have been shown to exist as a functional unit in vivo." . [] oboInOwl:hasDbXref "PMID:12853463" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1303 ; owl:annotatedTarget "A macromolecular complex of which the participants associate and dissociate in vivo. Weak transient complexes feature a dynamic oligomeric equilibrium in solution where the interaction is broken and formed continuously. Strong transient associations that require a molecular trigger to shift the oligomeric equilibrium." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0123 ; owl:annotatedTarget "[R:ac]" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1304 ; owl:annotatedTarget "A group of molecules linked by a high degree of similarity of sequence and/or function and not easily separated by participant identification methods." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1305 ; owl:annotatedTarget "A group of interactors hypothesized to perform a specified function. Example: Two splice variants of Raptor mRNA encode closely related proteins. One (member) has been shown to participate in formation of active mTORC complex; the other (candidate) is thought to do so." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1306 ; owl:annotatedTarget "A group of interactors that can be counted in principle but not in practice, such as mRNA or long-chain fatty acid. Examples - ceruloplasmin mRNA, palmitic acid." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1307 ; owl:annotatedTarget "Two or more interactors, grouped to denote interchangeable function. Thus the addition of a single nucleotide residue during RNA transcription could be annotated with the definedSet NTP (members ATP, CTP, GTP, and UTP)." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1308 ; owl:annotatedTarget """Used to specify the identity of the residue (or residues) introduced by mutation or variant (of child terms). The attribute would be used concurrently with the description provided in the feature name.""" . [] oboInOwl:hasDbXref "PMID:23474712", "PMID:23474714" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1309 ; owl:annotatedTarget "Hydrolytic reactions that release ADP-ribose." . [] oboInOwl:hasDbXref "PMID:23474712", "PMID:23474714" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1310 ; owl:annotatedTarget "Measure of hydrolytic reactions that release ADP-ribose." . [] oboInOwl:hasDbXref "PMID:10398392" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1311 ; owl:annotatedTarget "Differential scanning calorimetry (DSC) is a thermoanalytical technique in which the difference in the amount of heat required to increase the temperature of a sample and reference in solution is measured as a function of temperature. By measuring the temperature dependence of this partial heat capacity, a basic thermodynamic property, DSC gives immediate access to the thermodynamic mechanism that governs a conformational equilibrium, for example between a protein complex and its individual participants." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1311 ; owl:annotatedTarget "dsc" . [] oboInOwl:hasDbXref "PMID:12875839" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1312 ; owl:annotatedTarget "Method allowing the detection of interactions between two or more molecules by their very close proximity or the overlap of their respective bands in a SDS gel containing urea as an additional denaturing agent." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0123 ; owl:annotatedTarget "acetylarginine" . [] oboInOwl:hasDbXref "PMID:22412018" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1313 ; owl:annotatedTarget "Methods depend on a modification that only takes place with the close proximity of two molecules - a protein fused to the bait can then modify any neighbouring prey proteins, for example. The resulting tag can be used for isolation and/or identification." . [] oboInOwl:hasDbXref "PMID:22412018" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1314 ; owl:annotatedTarget "A promiscuous biotin protein ligase is fused to the bait protein, neighbouring prey are then biotinylated. The biotin tag may be used for isolation and/or identification." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1315 ; owl:annotatedTarget "The most accepted name in the literature for this complex." . [] oboInOwl:hasDbXref "PMID:22110040" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1317 ; owl:annotatedTarget "The ELM resource provides a database of curated short linear motif classes and instances, as well as a sequence analysis tool to detect putative short linear motif instances in query sequences. http://elm.eu.org/" . [] a owl:Axiom ; rdfs:label "[A-Za-z_0-9]+$" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_1317 ; owl:annotatedTarget "id-validation-regexp:" . [] a owl:Axiom ; rdfs:label "http://elm.eu.org/elms/elmPages/${ac}.html" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_1317 ; owl:annotatedTarget "search-url:" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1317 ; owl:annotatedTarget "elm" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1318 ; owl:annotatedTarget "Any molecule that is able to transfer a sulphate group to another chemical species." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1319 ; owl:annotatedTarget "Molecule to which a sulphate group may be transferred from a sulphate donor." . [] oboInOwl:hasDbXref "PMID:2261051" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1320 ; owl:annotatedTarget "Traditional yeast two hybrid assays are not suitable for the analysis of membrane proteins, as they require the interactions to occur in the nucleus. Methods have been specifically developed to assay for interactions of membrane proteins with both cytosolic or membrane-bound partners." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0123 ; owl:annotatedTarget "acetylarginine" . [] oboInOwl:hasDbXref "PMID:22665516" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1321 ; owl:annotatedTarget "Upon interaction of N-terminal generated Ire1p-fusions, the Ire1p kinase domains oligomerize, transphosphorylate and activate their C-terminal RNAseL domains, which specifically splice the mRNA of a transcriptional activator, Hac1. The expression of the mature form of Hac1p leads to the interaction-specific expression of a reporter. Specifically designed to identify interactors of proteins found in the endoplasmic reticulum." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1322 ; owl:annotatedTarget "Fluorescent tag - maleimide couples to thiols." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1323 ; owl:annotatedTarget "The protein is expressed as a hybrid protein fused to a tag containing an alkaline phosphatase activity. Subsequent observation or measurement of alkaline phosphatase activity is used to identify the presence of the molecule in an interaction." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1323 ; owl:annotatedTarget "tag alk phosphatase activity" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1324 ; owl:annotatedTarget "Molecule present in media harvested from cultured cells." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1325 ; owl:annotatedTarget "Measures the rate of a sulphate molecule transfer between two molecules." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1325 ; owl:annotatedTarget "sulfertransferase" . [] oboInOwl:hasDbXref "PMID:14755292", "PMID:16712436" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1326 ; owl:annotatedTarget "Reaction where a phosphate is transferred between two proteins of a phosphorelay system. " . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1326 ; owl:annotatedTarget "phosphotransfer" . [] oboInOwl:hasDbXref "GO:GO:0016783", "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1327 ; owl:annotatedTarget "Reaction where a sulfate group is transferred between two proteins" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0123 ; owl:annotatedTarget "alpha-acetylamino-delta-guanidinovaleric acid" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1327 ; owl:annotatedTarget "sulfurtransfer" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1328 ; owl:annotatedTarget "A class of labels derived from the benzopyrone coumarin." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1329 ; owl:annotatedTarget "The thiol-reactive coumarin, CPM is very weakly fluorescent until reacted with thiols producing a conjugate with excitation/emission maxima of ~384/470 nm." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1330 ; owl:annotatedTarget "Fluorescent dye. Also acts as an uncoupler of oxidative phosphorylation in the mitochondria." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1331 ; owl:annotatedTarget "The Evidence Ontology (ECO) describes types of scientific evidence within the realm of biological research that can arise from laboratory experiments, computational methods, manual literature curation, and other means." . [] a owl:Axiom ; rdfs:label "ECO:\\d{7}$" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_1331 ; owl:annotatedTarget "id-validation-regexp:" . [] a owl:Axiom ; rdfs:label "http://www.ebi.ac.uk/ols/ontologies/ECO/terms?obo_id=${ac}" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_1331 ; owl:annotatedTarget "search-url:" . [] oboInOwl:hasDbXref "PMID:21419760" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1332 ; owl:annotatedTarget "The Cardiovascular Gene Annotation Initiative represents a collaboration between University College London and the European Bioinformatics Institute (EBI), funded by the British Heart Foundation. This annotation group is a member of the IMEx Consortium." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1332 ; owl:annotatedTarget "BHF-UCL" . [] oboInOwl:hasDbXref "PMID:18823568" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1333 ; owl:annotatedTarget """SEGUID's are SHA-1 keys written in canonical base64 form with trailing = characters removed. ROG identifiers concatenate a SEGUID with a numerical taxonomy identifier. Therefore, the allowable characters in a SEGUID or ROG identifier are (in ascending ASCII or Unicode value): +/0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz Lists of SEGUID or ROG identifiers were sorted in ascending ASCII-based lexicographical order.""" . [] oboInOwl:hasDbXref "PMID:11125103" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0124 ; owl:annotatedTarget """Residue modification. OBSOLETE remap to MOD:00780.""" . [] oboInOwl:hasDbXref "PMID:18823568" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1334 ; owl:annotatedTarget "A global unique identifier to identify interactions that are identical. A RIG identifier (RIGID) is constructed by concatenating ROGID MI:1335 (after sorting them in ascending lexicographical order ), applying the SHA-1 algorithm to the resulting string, converting the digest to its base64 representation and removing all trailing \"=\" characters used for padding." . [] oboInOwl:hasDbXref "PMID:20946599" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1335 ; owl:annotatedTarget """Host-pathogen database. HPIDB integrates experimental PPIs from several public databases into a single, non-redundant web accessible resource. Manual curation is performed via the IntAct (ww.ebi.ac.uk/intact) curation interface. http://www.agbase.msstate.edu/hpi/main.html""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1335 ; owl:annotatedTarget "HPIDB" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1335 ; owl:annotatedTarget "Host Pathogen Interaction database" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1336 ; owl:annotatedTarget "Databases that contain information used to add additional information to experiments (meta-data)." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1336 ; owl:annotatedTarget "experiment xref" . [] oboInOwl:hasDbXref "pmid:20200009" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1337 ; owl:annotatedTarget "The Experimental Factor Ontology provides a systematic description of many experimental variables, combining parts of several biological ontologies to additional new terms." . [] a owl:Axiom ; rdfs:label "([A-Z]+:)?\\d{7}$" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_1337 ; owl:annotatedTarget "id-validation-regexp:" . [] a owl:Axiom ; rdfs:label "http://www.ebi.ac.uk/ols/ontologies/efo/terms?obo_id=${ac}" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_1337 ; owl:annotatedTarget "search-url:" . [] oboInOwl:hasDbXref "PMID:6204858" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1338 ; owl:annotatedTarget "Glu-Glu-Phe epitope tag, allowing its detection with rat monoclonal antibody YL1/2" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0012 ; owl:annotatedTarget "bret" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0124 ; owl:annotatedTarget "N-acetyl-L-asparagine" . [] oboInOwl:hasDbXref "PMID:17665911" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1339 ; owl:annotatedTarget "Mutated green fluorescent protein with altered net charge and thus altered intermolecular properties, such as resistence to aggregation." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1340 ; owl:annotatedTarget "A central resource of single-colony, fully-sequenced cloned human ORFs which can be readily transferred to Gateway compatible destination vectors for various functional proteomics studies. This set of ORFs ranges in size from 75 to more than 10,000 base pairs, and contains over 1,000 ORFs from genes with multiple splice variants." . [] a owl:Axiom ; rdfs:label "http://horfdb.dfci.harvard.edu/" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_1340 ; owl:annotatedTarget "search-url:" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1341 ; owl:annotatedTarget "Indicates that this protein is a member of a set of proteins with similar sequence and/or function." . [] oboInOwl:hasDbXref "PMID:19137101", "PMID:22158962", "PMID:23504432" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1342 ; owl:annotatedTarget "The quartz crystal microbalance is a physical technique that detects changes in the resonance frequency of an electrically driven quartz crystal with changes in mass. It provides qualitative and quantitative information about biomolecular interactions by translating changes in mass at the probe-immobilized surface of the crystal sensor into measurable changes in the resonant frequency of the quartz crystal. QCM-D enables real-time, label free measurements of molecular adsorption and/or interactions on various surfaces and is able to monitor conformational changes upon interactions." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1343 ; owl:annotatedTarget "Regulatory subunits of enzyme complexes can determine the activity level or specificity of catalytic subunits." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1344 ; owl:annotatedTarget "Fluoresceine-derived label." . [] oboInOwl:hasDbXref "PMID:12110672", "PMID:24943310" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1345 ; owl:annotatedTarget "A 9-amino acid peptide representing C terminus of bovine rhodopsin widely used as an epitope tag. A number of anti-rhodopsin antibodies recognize this epitope." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1345 ; owl:annotatedTarget "1D4 tag" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_1345 ; owl:annotatedTarget "rho1D4 tag" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0124 ; owl:annotatedTarget "NAC" . [] oboInOwl:hasDbXref "PMID:18288446" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1346 ; owl:annotatedTarget "Database for NMR spectroscopy information on biomolecules hosted at the University of Wisconsin, Madison, US." . [] oboInOwl:hasDbXref "PMID:24270789" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1347 ; owl:annotatedTarget "PRO provides an ontological representation of protein-related entities by explicitly defining them and showing the relationships between them. Each PRO term represents a distinct class of entities, including specific modified forms, orthologous isoforms, and protein complexes." . [] a owl:Axiom ; rdfs:label "[0-9]{9}|[A-Z][0-9][A-Z0-9]{3}[0-9]|[A-Z][0-9][A-Z0-9]{3}[0-9]-[1-9]+" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_1347 ; owl:annotatedTarget "id-validation-regexp:" . [] a owl:Axiom ; rdfs:label "http://pir.georgetown.edu/cgi-bin/pro/entry_pro?id=${ac}" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_1347 ; owl:annotatedTarget "search-url:" . [] a owl:Axiom ; rdfs:label "CHEMBL:[0-9]+" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_1348 ; owl:annotatedTarget "regexp:" . [] a owl:Axiom ; rdfs:label "http://www.ebi.ac.uk/chembldb/index.php/target/inspect/${ac}" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_1348 ; owl:annotatedTarget "search-url:" . [] oboInOwl:hasDbXref "PMID:24214965" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1349 ; owl:annotatedTarget "ChEMBL focuses on mapping the interactions of small molecules binding to their macromolecular targets." . [] oboInOwl:hasDbXref "PMID:19058507" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1350 ; owl:annotatedTarget "Orphanet is a reference portal for information on rare diseases and orphan drugs. Its aim is to help improve the diagnosis, care and treatment of patients with rare diseases." . [] a owl:Axiom ; rdfs:label "^\\d+$" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_1350 ; owl:annotatedTarget "id-validation-regexp:" . [] a owl:Axiom ; rdfs:label "http://www.ebi.ac.uk/ols/ontologies/ordo/terms?obo_id=${ac}" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_1350 ; owl:annotatedTarget "search-url:" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0124 ; owl:annotatedTarget "[N:ac]" . [] oboInOwl:hasDbXref "PMID:25313161" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1351 ; owl:annotatedTarget "Refers to the original experimentally verified object from which the described object has been derived." . [] oboInOwl:hasDbXref "PMID:18265086" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1352 ; owl:annotatedTarget "In uracil interference assays, the DNA will be amplified by PCR in the presence of a mixture of TTP and dUTP to randomly replace thymine by deoxyuracil residues before the binding assay. If T nucleotides involved in protein-DNA interactions are replaced by deoxyuracil, protein binding is prevented. After isolating the protein-DNA complex, DNA is cleaved with uracil-N-glycosylase, which specifically targets uracil bases, and the products are electrophoresed on a denaturing polyacrylamide gel. As a result, DNA in which a thymine involved in binding is replaced by uracil will be depleted. Hence, although the pattern looks like a footprint, the blank region means \"contact points\"." . [] oboInOwl:hasDbXref "PMID:9765280" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1353 ; owl:annotatedTarget "Epitope tag engineered onto the N- or C- terminus of a protein of interest so that the tagged protein can be analyzed and visualized by immunochemical methods. The recognized AU5 epitope represents the amino acid sequence TDFYLK." . [] oboInOwl:hasDbXref "PMID:14760721" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1354 ; owl:annotatedTarget "Cleavage (hydrolysis) of a lipid molecule." . [] oboInOwl:hasDbXref "PMID:14760721" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1355 ; owl:annotatedTarget "Reaction monitoring the cleavage (hydrolysis) or a lipid molecule." . [] oboInOwl:hasDbXref "PMID:25416956" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1356 ; owl:annotatedTarget "The protein pairs, often initially identified by a separate 2-hybrid screening methodology, are subjected to a rigorous re-analysis which may include independent re-screening of the entire search space, retesting the assay in different strain backgrounds, and multiple retesting of identified protein pairs reversing bait-prey orientations. Orthogonal data from other experimental and bioinformatic approaches may also be used to support the identification of the final high-confidence protein pairs but the primary means of selection must be experimentally based. This method would be expected to identify protein pairs with a higher degree of confidence than any single protein complementation technique." . [] oboInOwl:hasDbXref "PMID:25352543" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_1357 ; owl:annotatedTarget "Provides unified access to the ncRNA sequence data supplied by the expert databases." . [] a owl:Axiom ; rdfs:label "/URS[0-9A-F]{10}/i" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_1357 ; owl:annotatedTarget "id-validation-regexp:" . [] a owl:Axiom ; rdfs:label "http://rnacentral.org/rna/${ac}" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_1357 ; owl:annotatedTarget "search-url:" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2002 ; owl:annotatedTarget "DrugBank Accession number consisting of the 4 letter prefix and a 5 number suffix. Each Accession number is unique to the drug's generic name. The 4 letter suffix (APRD, EXPT, BIOD, NUTR) indicates the type of drug (APRD=approved small molecule drug, EXPT=experimental drug, BIOD=biotech drug, NUTR=nutraceutical or natural product). Biotech drugs consist of FDA approved peptide, protein or nucleic acid drugs, approved small molecule drugs are FDA approved non-biotech drugs, nutraceuticals are natural products (amino acids, vitamins, other metabolites) and experimental drugs include drugs under trial, pre-clinical drugs, unapproved drugs, well known inhibitors and possible toxins." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0124 ; owl:annotatedTarget "acetylasparagine" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2003 ; owl:annotatedTarget "Standard name of drug or any reagent as provided by its manufacturer." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2003 ; owl:annotatedTarget "generic name" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2004 ; owl:annotatedTarget "Alternate names of the drug, brand names from different manufacturers." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2005 ; owl:annotatedTarget "Brand names and composition of mixtures that include the drug described in this DrugCard file." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2005 ; owl:annotatedTarget "mix brand name" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2006 ; owl:annotatedTarget "Description of the drug (for biotech drugs) describing its composition and/or preparation." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2006 ; owl:annotatedTarget "biotech prep" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2007 ; owl:annotatedTarget "IUPAC or standard chemical name for a drug, or a chemical." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2008 ; owl:annotatedTarget "Chemical formula describing atomic or elemental composition" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2009 ; owl:annotatedTarget "Image of the drug structure (if small molecule) or its sequence (if biotech drug)" . [] oboInOwl:hasDbXref "PMID:11125103", "RESID:AA0042" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0125 ; owl:annotatedTarget """Residue modification. OBSOLETE remap to MOD:00051.""" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2010 ; owl:annotatedTarget "IUPAC International Chemical Identifier (InChI) - a machine-readable character string describing a chemical structure, developed by IUPAC and the InChI Trust as a standard to allow interoperability and linking between chemical resources. The standard InChI differs from the non-standard InChI in that it is generated with a fixed set of parameters, ensuring consistency between different resources. The current version of the standard InChI software is 1.03." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2010 ; owl:annotatedTarget "standard inchi" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2011 ; owl:annotatedTarget "Chemical Abstract Service identification number" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2012 ; owl:annotatedTarget "Kyoto Encyclopedia of Genes and Genomes compound identification number (if molecule is in KEGG)" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2012 ; owl:annotatedTarget "KEGG Compound ID" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2013 ; owl:annotatedTarget """NCBI's PubChem database identification number (if molecule is in PubChem). OBSOLETE as redudant with MI:0730""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2013 ; owl:annotatedTarget "PubChem ID" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2015 ; owl:annotatedTarget "Pharmacogenomics Knowledge Base identification number (if molecule is in PharmGKB)" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2016 ; owl:annotatedTarget "BIND database Small Molecule Identification number (if molecule is in BIND)" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2017 ; owl:annotatedTarget """The HET records are used to describe non-standard residues, such as prosthetic groups, inhibitors, solvent molecules, and ions for which coordinates are supplied. Groups are considered HET if they are: - not one of the standard amino acids, and - not one of the nucleic acids (C, G, A, T, U, and I), and - not one of the modified versions of nucleic acids (+C, +G, +A, +T, +U, and +I), and - not an unknown amino acid or nucleic acid where UNK is used to indicate the unknown residue name. Het records also describe heterogens for which the chemical identity is unknown, in which case the group is assigned the hetID UNK.""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0125 ; owl:annotatedTarget "(S)-2-(acetylamino)butanedioic acid" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2017 ; owl:annotatedTarget "het" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2020 ; owl:annotatedTarget "Drug Identification Number (Canadian Drug ID system)" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2020 ; owl:annotatedTarget "din" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2021 ; owl:annotatedTarget "Hyperlink to RxList entry for the given drug (if it exists)" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2023 ; owl:annotatedTarget "Material Safety Data Sheet (if it exists). A Material Safety Data Sheet (MSDS) is designed to provide both workers and emergency personnel with the proper procedures for handling or working with a particular substance. MSDS's include information such as physical data (melting point, boiling point, flash point etc.), toxicity, health effects, first aid, reactivity, storage, disposal, protective equipment, andspill/leak procedures. These are of particular use if a spill or other accident occurs." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2023 ; owl:annotatedTarget "MSDS Material Safety Sheet" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2023 ; owl:annotatedTarget "msds" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2024 ; owl:annotatedTarget "number of the patent describing a drug's synthesis or use." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2025 ; owl:annotatedTarget "Molecular weight in g/mol, determined from molecular formula or sequence." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2026 ; owl:annotatedTarget "The melting point of a solid is the temperature range at which it changes state from solid to liquid." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0125 ; owl:annotatedTarget "DAC" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2027 ; owl:annotatedTarget "Water solubility in mg/mL or g/L" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2027 ; owl:annotatedTarget "logSw" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2029 ; owl:annotatedTarget "Water/octanol partition coefficient of a small molecule." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2030 ; owl:annotatedTarget "The isoelectric point (pI) is the pH at which a particular molecule or surface carries no net electrical charge. For an amino acid with only one amine and one carboxyl group, the pI can be calculated from the pKas of this molecule." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2033 ; owl:annotatedTarget "Physical property of a molecule (known as a hydrophobe) that is repelled from a mass of water. Gravy score." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2036 ; owl:annotatedTarget "The boiling point of a liquid is the temperature at which the vapor pressure of the liquid equals the environmental pressure surrounding the liquid. A liquid in a vacuum environment has a lower boiling point than when the liquid is at atmospheric pressure. A liquid in a high pressure environment has a higher boiling point than when the liquid is at atmospheric pressure. In other words, the boiling point of liquids varies with and depends upon the surrounding environmental pressure." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2039 ; owl:annotatedTarget "SMILES string corresponding to drug structure" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2040 ; owl:annotatedTarget "Type of drug (approved, experimental, biotech, nutraceutical)" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2041 ; owl:annotatedTarget "Therapeutic category or general category of drug (anti-convulsant, antibacterial, etc.)." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2042 ; owl:annotatedTarget "Description or common names of diseases that the drug is used to treat." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0125 ; owl:annotatedTarget "N-acetyl-L-aspartic acid" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2043 ; owl:annotatedTarget "Text description of how the drug works at a clinical or physiological level." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2044 ; owl:annotatedTarget "Description of how the drug works or what it binds to at a molecular level." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2045 ; owl:annotatedTarget "Determination of how quickly and how much of a drug reaches its intended target (site) of action." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2046 ; owl:annotatedTarget "The LD50 is the dose that kills half (50%) of the animals tested" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2046 ; owl:annotatedTarget "ld50" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2046 ; owl:annotatedTarget "lethal dose 50 %" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2047 ; owl:annotatedTarget "Percentage of the drug that is bound in plasma proteins" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2047 ; owl:annotatedTarget "plasma prot binding" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2047 ; owl:annotatedTarget "protein binding %" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2048 ; owl:annotatedTarget "The chemical conversion of drugs to other compounds in the body, excluding degradation due to any inherent chemical instability of drugs in biological media." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0125 ; owl:annotatedTarget "[D:ac]" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2048 ; owl:annotatedTarget "drug metabolism" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2049 ; owl:annotatedTarget "Rate The time it takes for the body to eliminate or breakdown half of a dose of a pharmacologic agent, in practice the time taken for plasma concentration to reduce by 50%." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2049 ; owl:annotatedTarget "distribution halflife" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2049 ; owl:annotatedTarget "elimin half life" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2049 ; owl:annotatedTarget "t1/2" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2050 ; owl:annotatedTarget "How the drug is dispensed (tablets, capsules, solutions), packing material." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2051 ; owl:annotatedTarget "Information on the disease indications and treatment regime for the drug. May also include contra-indications." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2053 ; owl:annotatedTarget "Cautions or conditions indicating why or when the drug should not be taken or prescribed." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2054 ; owl:annotatedTarget "General on-line reference to other details about a drug or other bioactive entity." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2054 ; owl:annotatedTarget "bioactive entity ref" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0125 ; owl:annotatedTarget "acetylaspartate" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2055 ; owl:annotatedTarget "chemical stability occurs when a substance is in a (dynamic) chemical equilibrium with its environment. In this well-defined state, the substance is expected to persist indefinitely (assuming that the environment does not change). A substance which is not chemically stable (yet exists) is metastable or kinetically persistent." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2055 ; owl:annotatedTarget "thermodynamic stability" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2064 ; owl:annotatedTarget "Potential ability of a substance to dissolve in a liquid." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2064 ; owl:annotatedTarget "dt theoretical pi" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2084 ; owl:annotatedTarget "Names of organisms which are affected, positively or negatively, by the drug." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2086 ; owl:annotatedTarget "Chemical and physical properties of a molecule." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2086 ; owl:annotatedTarget "physicochemical att" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2089 ; owl:annotatedTarget "Properties of a chemical tested or used as a drug, herbicide, insecticide etc." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2089 ; owl:annotatedTarget "bioactive entity att" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2091 ; owl:annotatedTarget "Human artefact to describe and report the structure of a molecule." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0013 ; owl:annotatedTarget "The application of physical principles and methods to biological experiments." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0125 ; owl:annotatedTarget "acetylaspartic acid" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2091 ; owl:annotatedTarget "struc representation" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2097 ; owl:annotatedTarget "Therapeutic category or general category of drug -anti-convulsant" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2098 ; owl:annotatedTarget "Therapeutic category or general category of drug -anti-bacterial" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2099 ; owl:annotatedTarget "A drug licensed for sale in the USA by the FDA." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2100 ; owl:annotatedTarget "A drug which has yet to be formally approved for the indication which it is currently being used to treat." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2101 ; owl:annotatedTarget "A natural product, such as a protein or peptide, which is produced used biotechnology as a drug." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2102 ; owl:annotatedTarget "A drug which may also be regarded as a foodstuff." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2105 ; owl:annotatedTarget "Negative decimal logarithm of Ka, acid dissociation equilibrium constant for the dissociation of a weak acid." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2106 ; owl:annotatedTarget "The degree of ionization refers to the proportion of neutral particles such as those in a gas or aqueous solution, that are ionized into charged particles. A low degree of ionization is sometimes called partially ionized, and a very high degree of ionization as fully ionized. This measurment is performed at pH 7.4" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2106 ; owl:annotatedTarget "ionisation ph 7.4" . [] oboInOwl:hasDbXref "PMID:11125103", "RESID:AA0043" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0126 ; owl:annotatedTarget """Residue modification. OBSOLETE remap to MOD:00052.""" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2107 ; owl:annotatedTarget "The LogD is the ratio of the equilibrium concentrations of all species (unionized and ionized) of a molecule in octanol to same species in the water phase at a given temperature, normally 25 C. It differs from LogP in that ionized species are considered as well as the neutral form of the molecule.pH 7.4" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2108 ; owl:annotatedTarget "Solubility pH 7.4" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2109 ; owl:annotatedTarget "Solubility in DMSO" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2111 ; owl:annotatedTarget "Diffusion coefficient D is proportional to the velocity of the diffusing particles, which depends on the temperature, viscosity of the fluid and the size of the particles according to the Stokes-Einstein relation. In dilute aqueous solutions the diffusion coefficients of most ions are similar and have values that at room temperature are in the range of 0.6x10-9 to 2x10-9 m2/s. For biological molecules the diffusion coefficients normally range from 10-11 to 10-10 m2/s." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2111 ; owl:annotatedTarget "diffusion coeff" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2112 ; owl:annotatedTarget "Chemical stability at pH 2" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2112 ; owl:annotatedTarget "chem stab ph 2" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2113 ; owl:annotatedTarget "The rate of dissolution is a key target for controlling the duration of a drug's effect, and as such, several dosage forms that contain the same active ingredient may be available, differing only in the rate of dissolution. If a drug is supplied in a form that is not readily dissolved, the drug may be released more gradually over time with a longer duration of action. Having a longer duration of action may improve compliance since the medication will not have to be taken as often. Additionally, slow-release dosage forms may maintain concentrations within an acceptable therapeutic range over a long period of time, as opposed to quick-release dosage forms which may result in sharper peaks and troughs in serum concentrations." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2115 ; owl:annotatedTarget "Determination of the fate of substances administered externally to a living organism i.e. the study of what the body does to a drug." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2116 ; owl:annotatedTarget "The permitting or activating of the passage of substances into, out of, or through cells." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0126 ; owl:annotatedTarget "(R)-2-acetylamino-3-sulfanylpropanoic acid" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2118 ; owl:annotatedTarget "The Volume of Distribution is the amount of drug in the body divided by the concentration in the blood. Drugs that are highly lipid soluble have a very high volume of distribution (500 litres). Drugs which are lipid insoluble remain in the blood, and have a low Vd." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2118 ; owl:annotatedTarget "distribution volume" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2118 ; owl:annotatedTarget "vd" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2118 ; owl:annotatedTarget "vol of distribution" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2120 ; owl:annotatedTarget "Accumulation of a drug or chemical substance in various organs (including those not relevant to its pharmacologic or therapeutic action). This distribution depends on the blood flow or perfusion rate of the organ, the ability of the drug to penetrate organ membranes, tissue specificity, protein binding. The distribution is usually expressed as tissue to plasma ratios." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2121 ; owl:annotatedTarget "Substrate of a carrier system allowing the intake of an agent into an organ or part of body." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2122 ; owl:annotatedTarget "The ratio of excretion is or measure of the speed at which a constituent is lost from the body." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2123 ; owl:annotatedTarget "The renal clearance ratio or fractional excretion is a measure of the speed at which a constituent of urine passes through the kidneys, in this context the rate at which a pharmacological agent is lost from the body via urine." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2124 ; owl:annotatedTarget "The clearance of a drug is the volume of plasma from which the drug is completely removed per unit time. The amount eliminated is proportional to the concentration of the drug in the blood." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2124 ; owl:annotatedTarget "cl" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0126 ; owl:annotatedTarget "2-acetylamino-3-mercaptopropanoic acid" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2124 ; owl:annotatedTarget "clearance" . [] oboInOwl:hasDbXref "PMID:8987073" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2125 ; owl:annotatedTarget "The Maximum Absorbable Dose (MAD) represents the amount of drug that can permeate across a barrier." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2125 ; owl:annotatedTarget "mad" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2126 ; owl:annotatedTarget "Water soluble compounds are absorbed in the small intestine mainly via two pathways, the transcellular and the paracellular pathways. The paracellular absorption involves movement of solutes through a restrictive aqueous channel in the tight junctions of adjoining cells by diffusion." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2126 ; owl:annotatedTarget "paracellular absorp" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2127 ; owl:annotatedTarget "Ratio between the time value at Cmax (maximum concentration) in a dose response curve, and the Cmax value itself." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2128 ; owl:annotatedTarget "Substrate for the representitive member of the ABC transprorter family ABCB1 (MDR1, pgy1, P08183). ABC transporters preventing uptake or facilitating clearance of toxic substances, playing an important role in drug excretion through the bile." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2128 ; owl:annotatedTarget "abcb1 substrate" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2128 ; owl:annotatedTarget "pgp(mdr1) substrate " . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2129 ; owl:annotatedTarget "Substrate of the bile acid carrier system in both the intestinal tract and the liver. System catalyses of the transfer of bile acid from one side of the membrane to the other. Bile acids are any of a group of steroid carboxylic acids occurring in bile, where they are present as the sodium salts of their amides with glycine or taurine." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0126 ; owl:annotatedTarget "CAC" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2129 ; owl:annotatedTarget "bile trans substrate" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2130 ; owl:annotatedTarget "Inhibitor of one or more of the family of cytochrome p450 enzymes, probably the most important elements of oxidative metabolism of exogenous compounds." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2130 ; owl:annotatedTarget "Cytochrome P450 inhibition" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2130 ; owl:annotatedTarget "cyp-450 inhibition" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2131 ; owl:annotatedTarget "Identification of the breakdown products of a substance, either through chemical instability or the actions of enzymes within the body" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2131 ; owl:annotatedTarget "metabolite identific" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2132 ; owl:annotatedTarget "Derivative molecule which has formed from a reaction with glutathione." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2133 ; owl:annotatedTarget "Neutralization of a compound occuring via its glucuronidation or sulfatation." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2133 ; owl:annotatedTarget "neutraliz gluc/sulf" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2135 ; owl:annotatedTarget "The mechanism by which a substance can harm humans or animals." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0126 ; owl:annotatedTarget "N-acetyl-L-cysteine" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2136 ; owl:annotatedTarget "Binds to the hERG (human Ether-a-go-go Related Gene) (Q12809) which encodes the Kv11.1 potassium ion channel responsible for the repolarizing IKr current in the cardiac action potential." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2137 ; owl:annotatedTarget "Tendency of a bioactive entity to induce damage at the level of the gene." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2138 ; owl:annotatedTarget "Tendency of a bioactive entity to induce genetic mutations at the nucleotide level e.g. substitution of nucleotide base-pairs and insertions and deletions of one or more nucleotides in DNA sequences." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2139 ; owl:annotatedTarget "Tendency of a bioactive entity to induce a cancer." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2139 ; owl:annotatedTarget "cancerogenicity" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2140 ; owl:annotatedTarget "Tendency of a bioactive entity to induce damage at the level of the chromosome e.g. induce a change in chromosome structure and number." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2141 ; owl:annotatedTarget "Tendency of a bioactive entity to affect liver function." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2142 ; owl:annotatedTarget "Causes excess phospholipids to accumulate within cells." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2145 ; owl:annotatedTarget "Solubility pH 6.5." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2146 ; owl:annotatedTarget "Solubility pH 2.0" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0126 ; owl:annotatedTarget "N-acetylcysteine" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2146 ; owl:annotatedTarget "solubility ph2.0" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2147 ; owl:annotatedTarget "Chemical stabilityat at pH 7.4" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2147 ; owl:annotatedTarget "chem stab ph 7.4" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2148 ; owl:annotatedTarget "A drug currently under clinical development." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2149 ; owl:annotatedTarget "A drug for which the licencing for prescriptive use has been withdrawn." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2150 ; owl:annotatedTarget "A drug which has not been approved for sale, a drug taken for recreational purposes or a licensed drug sold without a prescription." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2151 ; owl:annotatedTarget "Effect of additional drug treatments on a given drug action." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2151 ; owl:annotatedTarget "drug interaction" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2152 ; owl:annotatedTarget "Effect of food ingestion on a given drug treatment." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2153 ; owl:annotatedTarget "Hyperlink to PDRhealth entry for the given drug (if it exists)" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0126 ; owl:annotatedTarget "[C:ac]" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2153 ; owl:annotatedTarget "PDRhealth" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2154 ; owl:annotatedTarget "Hyperlink to wikipedia entry for the given drug (if it exists)" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2155 ; owl:annotatedTarget "Molecular weight in g/mol, determined from molecular formula or sequence." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2155 ; owl:annotatedTarget "avrg mol weight" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2156 ; owl:annotatedTarget "Molecular weight in g/mol, determined from molecular formula or sequence." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2156 ; owl:annotatedTarget "monoisotopic mol wgt" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2157 ; owl:annotatedTarget "Water solubility in mg/mL or g/L." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2157 ; owl:annotatedTarget "exp h2o solubilty" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2157 ; owl:annotatedTarget "experimental h2o solubility" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2158 ; owl:annotatedTarget "Water solubility in mg/mL or g/L" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0126 ; owl:annotatedTarget "acetylcysteine" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2158 ; owl:annotatedTarget "predicted h2o solub" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2158 ; owl:annotatedTarget "predicted h2o solubility" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2160 ; owl:annotatedTarget "Solubility of a molecule in a given solvant." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2160 ; owl:annotatedTarget "logS" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2161 ; owl:annotatedTarget "Experimental derived value for the solubility of a molecule in a given solvant." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2161 ; owl:annotatedTarget "experimental logS" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2162 ; owl:annotatedTarget "Experimentally derived value for ability of a compound to cross epithelial and endothelial cell barriers Using the CaCo2 cell line derived from a human colorectal adenocarcinoma. Used as an in vitro permeability models to predict human intestinal absorption" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2162 ; owl:annotatedTarget "caco2 permeability" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2163 ; owl:annotatedTarget "Reference assigned to a molecule by sequence homology with another similar sequence." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2164 ; owl:annotatedTarget "The Membrane-based Interactome Network Database (MIND) holds a network of over 25,000 putative PPI (PPPI) obtained by screening of over 3,000 unique Arabidopsis ORFs for pair-wise interactions using the yeast mating-based split-ubiquitin system (mbSUS). http://cas-biodb.cas.unt.edu/project/mind/index.php" . [] oboInOwl:hasDbXref "PMID:11125103", "RESID:AA0045" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0127 ; owl:annotatedTarget """Residue modification. OBSOLETE remap to MOD:00054.""" . [] oboInOwl:hasDbXref "PMID:15960624" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2165 ; owl:annotatedTarget "The Arabidopsis Interactions Viewer of BAR (the Bio-Array Resource for plant biology) queries a database of 70944 predicted and 28556 confirmed Arabidopsis interacting proteins. The predicted interactions (interologs) were generated by Drs Matt Geisler and Jane Geisler-Lee at the Southern Illinois University. Their current version is Interactome 2.0. The confirmed Arabidopsis interacting proteins come from BIND, the Biomolecular Interaction Network Database, from high-density Arabidopsis protein microarrays, from Braun et al.'s Arabidopsis Interactome 2011 , from Wolf Frommer's Membrane protein INteractome Database MIND, from Etsuko Moryiama's Arabidopsis G-signaling Interactome Database, and over 1190 other literature sources. The interactions in BIND were identified using several different methods, such as yeast two hybrid screens, but also via traditional biochemical methods. http://bar.utoronto.ca/interactions/cgi-bin/arabidopsis_interactions_viewer.cgi\" [PMID:15960624]" . [] oboInOwl:hasDbXref "PMID:21798944" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2166 ; owl:annotatedTarget """The Arabidopsis Interactome network map is a proteome-wide binary protein-protein interaction map for the interactome network of the plant Arabidopsis thaliana containing ~6,200 highly reliable interactions between ~2,700 proteins. http://interactome.dfci.harvard.edu/A_thaliana/index.php""" . [] oboInOwl:hasDbXref "PMID:15674023" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2167 ; owl:annotatedTarget "In the kinetic exclusion assay one of the interaction components (bait) is immobilized to a solid phase (beads) and is used to capture the prey from a solution containing free molecules of both the prey and the bait that has reached kinetic equilibrium. This mixture of free components is only allowed to contact the immobilized bait for a very short time, so bait-prey complexes do not dissociate. The immobilized bait captures a small percentage of the prey, which is proportional to the free prey concentration, and the captured prey is detected usually via a fluorescent tag." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2167 ; owl:annotatedTarget "kinetic exclusion" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2167 ; owl:annotatedTarget "kinexa" . [] oboInOwl:hasDbXref "PMID:19416890" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2168 ; owl:annotatedTarget "The interaction is detected through labelling of a specific site -which can be an active site- that is only accessible once the participants are interacting. This conditional site is then marked with a chemical label for detection." . [] oboInOwl:hasDbXref "PMID:24166364" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2169 ; owl:annotatedTarget "Techniques based upon the measurement of the emission of one or more photons in a bioluminescent reaction. Such reactions are typically catalyzed by two groups of enzymes: photoproteins and luciferases. Photoproteins emit light in proportion to the concentration of the protein itself, while in a luciferin-luciferase reaction, photon emission is directly proportional to the amount of luciferin." . [] oboInOwl:hasDbXref "PMID:25859972" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2170 ; owl:annotatedTarget "The bimolecular luminescence complementation (BiLC) is an assay for determination of protein interactions and/or their location in living cells. This approach is based on complementation between two fragments of a bioluminescent enzyme such as luciferin or aequorin. Interactions between proteins fused to each fragment bring the fragments together resulting in the reconstitution of a fully functional bioluminescent enzyme that can be identified through microscopy or luminescence detection." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2170 ; owl:annotatedTarget "bilc" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2170 ; owl:annotatedTarget "bioluminescence complementation" . [] oboInOwl:hasDbXref "PMID:9576956" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0014 ; owl:annotatedTarget "Adenylate cyclase is encoded by the cyaA gene and contains a catalytic domain which can be proteolytically cleaved into two complementary fragments, T25 and T18, which remain associated in the presence of calmodulin in a fully active ternary complex. In the absence of calmodulin, the mixture of the two fragments does not exhibit detectable activity, suggesting that the two fragments do not associate. When expressed in an adenylate cyclase-deficient E. coli strain (E. coli lacks calmodulin or calmodulin-related proteins), the T25 and T18 fragments fused to putative interacting proteins are brought into close association which result in cAMP synthesis. The level of reconstructed adenylate cyclase can be estimated by monitoring the expression of a cAMP dependent reporter gene. The T25 tagged protein is generally regarded as the bait, the T18 as the prey." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0127 ; owl:annotatedTarget "(S)-2-acetylamino-5-pentanediamic acid" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2170 ; owl:annotatedTarget "bioluminescence complementation assay" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2170 ; owl:annotatedTarget "luminescence complementation assay" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2170 ; owl:annotatedTarget "luminiscence complementation" . [] oboInOwl:hasDbXref "PMID:21785426", "PMID:25706338" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2171 ; owl:annotatedTarget "This technology is based on quantifying the BRET between a pair of participants bearing complementation tags and a participant tagged with a bioluminescent enzyme or a fluorescent tag. The tags held by the pair of participants are complementary halves of either a fluorescent tag (N- and C- fragments of the Venus fluorescent protein, for example) or a bioluminescent enzyme (N- and C- fragments of Renilla luciferase, for example). Interaction between the pair of participants leads to reconstruction of the bioluminescent enzyme/fluorescent protein, which can then emit/accept photons that are accepted/emitted by the tag in the third participant, generating the signal used to detect the interaction. The signals emitted by the bioluminescent enzyme and the fluorescent tag have different wavelengths, so they can be distinguished." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2171 ; owl:annotatedTarget "bret complementation" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2171 ; owl:annotatedTarget "bret complementation assay" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2171 ; owl:annotatedTarget "copa-ret" . [] oboInOwl:hasDbXref "PMID:24194595" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2172 ; owl:annotatedTarget """AspGD is an organized collection of genetic and molecular biological information about the filamentous fungi of the genus Aspergillus. Among its many species, the genus contains an excellent model organism (A. nidulans, or its teleomorph Emericella nidulans), an important pathogen of the immunocompromised (A. fumigatus), an agriculturally important toxin producer (A. flavus), and two species used in industrial processes (A. niger and A. oryzae). AspGD contains information about genes and proteins of multiple Aspergillus species; descriptions and classifications of their biological roles, molecular functions, and subcellular localizations; gene, protein, and chromosome sequence information; tools for analysis and comparison of sequences; and links to literature information; as well as a multispecies comparative genomics browser tool (Sybil) for exploration of orthology and synteny across multiple sequenced Aspergillus species. www.aspergillusgenome.org/""" . [] a owl:Axiom ; rdfs:label "ASPL[0-9]{10}" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_2172 ; owl:annotatedTarget "id-validation-regexp:" . [] a owl:Axiom ; rdfs:label "http://www.aspergillusgenome.org/cgi-bin/locus.pl?dbid=${ac}" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_2172 ; owl:annotatedTarget "search-url:" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0127 ; owl:annotatedTarget "N-acetyl-L-glutamine" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2172 ; owl:annotatedTarget "AspGD" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2172 ; owl:annotatedTarget "Aspergillus Genome Database" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2172 ; owl:annotatedTarget "aspgd" . [] oboInOwl:hasDbXref "PMID:22064862" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2173 ; owl:annotatedTarget """Candida Genome Database is a resource for genomic sequence data and gene and protein information for Candida albicans and related species. CGD is based on the Saccharomyces Genome Database and is funded by the National Institute of Dental & Craniofacial Research at the US National Institutes of Health. www.candidagenome.org/""" . [] a owl:Axiom ; rdfs:label "(CAL|CAF)[0-9]{7}" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_2173 ; owl:annotatedTarget "id-validation-regexp:" . [] a owl:Axiom ; rdfs:label "http://www.candidagenome.org/cgi-bin/locus.pl?dbid=${ac}" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_2173 ; owl:annotatedTarget "search-url:" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2173 ; owl:annotatedTarget "CGD" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2173 ; owl:annotatedTarget "Candida Genome Database" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2173 ; owl:annotatedTarget "cgd" . [] oboInOwl:hasDbXref "PMID:22064863" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2174 ; owl:annotatedTarget """Community annotation portal associated with PortEco (formerly EcoliHub, http://porteco.org/). It aims to generate community-based pages about everything related to non-pathogenic E. coli, its phages, plasmids, and mobile genetic elements. http://ecoliwiki.net/colipedia/""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0127 ; owl:annotatedTarget "QAC" . [] a owl:Axiom ; rdfs:label "[A-Za-z]{3,4}" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_2174 ; owl:annotatedTarget "id-validation-regexp:" . [] a owl:Axiom ; rdfs:label "http://ecoliwiki.net/colipedia/${ac}" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_2174 ; owl:annotatedTarget "search-url:" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2174 ; owl:annotatedTarget "EcoliWiki" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2174 ; owl:annotatedTarget "ecoliwiki" . [] oboInOwl:hasDbXref "PMID:22116062" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2175 ; owl:annotatedTarget """The GeneDB project is a core part of the Sanger Institute's Pathogen Genomics activities. Its primary goals are: -to provide reliable access to the latest sequence data and annotation/curation for the whole range of organisms sequenced by the Pathogen group. -to develop the website and other tools to aid the community in accessing and obtaining the maximum value from these data. GeneDB currently provides access to more than 40 genomes, at various stages of completion, from early access to partial genomes with automatic annotation through to complete genomes with extensive manual curation. www.genedb.org""" . [] a owl:Axiom ; rdfs:label "((LmjF|LinJ|LmxM)\\.[0-9]{2}\\.[0-9]{4})|(PF3D7_[0-9]{7})|(Tb[0-9]+\\.[A-Za-z0-9]+\\.[0-9]+)|(TcCLB\\.[0-9]{6}\\.[0-9]+)" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_2175 ; owl:annotatedTarget "id-validation-regexp:" . [] a owl:Axiom ; rdfs:label "www.genedb.org/gene/${ac}" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_2175 ; owl:annotatedTarget "search-url:" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2175 ; owl:annotatedTarget "GeneDB" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2175 ; owl:annotatedTarget "genedb" . [] oboInOwl:hasDbXref "PMID:24217918" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2176 ; owl:annotatedTarget """Gramene is a curated, open-source, integrated data resource for comparative functional genomics in crops and model plant species. Gramene currently hosts annotated whole genomes in over two dozen plant species and partial assemblies for almost a dozen wild rice species in the Ensembl browser, genetic and physical maps with genes, ESTs and QTLs locations, genetic diversity data sets, structure-function analysis of proteins, plant pathways databases (BioCyc and Plant Reactome platforms), and descriptions of phenotypic traits and mutations. http://www.gramene.org""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0127 ; owl:annotatedTarget "[Q:ac]" . [] a owl:Axiom ; rdfs:label "[A-Z][0-9][A-Z0-9]{3}[0-9]" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_2176 ; owl:annotatedTarget "id-validation-regexp:" . [] a owl:Axiom ; rdfs:label "http://tools.gramene.org/search?query=${ac}" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_2176 ; owl:annotatedTarget "search-url:" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2176 ; owl:annotatedTarget "Gramene" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2176 ; owl:annotatedTarget "gramene" . [] oboInOwl:hasDbXref "PMID:22039153" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2177 ; owl:annotatedTarget """PomBase is a comprehensive database for the fission yeast Schizosaccharomyces pombe, providing structural and functional annotation, literature curation and access to large-scale data sets. www.pombase.org""" . [] a owl:Axiom ; rdfs:label "S\\w+(\\.)?\\w+(\\.)?" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_2177 ; owl:annotatedTarget "id-validation-regexp:" . [] a owl:Axiom ; rdfs:label "www.pombase.org/spombe/result/${ac}" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_2177 ; owl:annotatedTarget "search-url:" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2177 ; owl:annotatedTarget "PomBase" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2177 ; owl:annotatedTarget "pombase" . [] a owl:Axiom ; rdfs:label "A[Tt][MmCc0-5][Gg][0-9]{5}(\\.[0-9]{1})?" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_2178 ; owl:annotatedTarget "id-validation-regexp:" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0127 ; owl:annotatedTarget "acetylglutamine" . [] a owl:Axiom ; rdfs:label "http://arabidopsis.org/servlets/TairObject?type=locus&name=${ac}" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_2178 ; owl:annotatedTarget "search-url:" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2178 ; owl:annotatedTarget "AGI_LocusCode" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2178 ; owl:annotatedTarget "Arabidopsis Genome Initiative" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2178 ; owl:annotatedTarget "agi_locuscode" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2179 ; owl:annotatedTarget "Reference to the corresponding object in another database. It implies the object is part of a cross-referenced entity (usually a complex)." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2179 ; owl:annotatedTarget "part of" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2179 ; owl:annotatedTarget "subset" . [] oboInOwl:hasDbXref "PMID:21075795" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2180 ; owl:annotatedTarget """AgBase is a curated, open-source, Web-accessible resource for functional analysis of agricultural plant and animal gene products. Their long-term goal is to serve the needs of the agricultural research communities by facilitating post-genome biology for agriculture researchers and for those researchers primarily using agricultural species as biomedical models. They use the Gene Ontology for functional annotation. http://www.agbase.msstate.edu/""" . [] a owl:Axiom ; rdfs:label "http://www.agbase.msstate.edu/cgi-bin/getEntry.pl?db_pick=[ChickGO/MaizeGO]&uid=${ac}" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_2180 ; owl:annotatedTarget "search-url:" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2180 ; owl:annotatedTarget "AgBase" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0127 ; owl:annotatedTarget "acetylglutamine" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2180 ; owl:annotatedTarget "agbase" . [] a owl:Axiom ; rdfs:label "http://gowiki.tamu.edu/wiki/index.php/${ac}" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_2181 ; owl:annotatedTarget "search-url:" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2181 ; owl:annotatedTarget "CACAO" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2181 ; owl:annotatedTarget "Community Assessment of Community Annotation with Ontologies" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2181 ; owl:annotatedTarget "cacao" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2182 ; owl:annotatedTarget "DFLAT" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2182 ; owl:annotatedTarget "Developmental FunctionaL Annotation at Tufts" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2182 ; owl:annotatedTarget "dflat" . [] oboInOwl:hasDbXref "PMID:19578431" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2183 ; owl:annotatedTarget """The GO Consortium coordinated an effort to maximize and optimize GO annotations for a large and representative set of key genomes, known as 'reference genomes'. The Reference Genome Annotation Project aimed to completely annotate twelve reference genomes, producing a resource that may effectively seed automatic annotation efforts of other genomes. This resource represents manual annotation from PAINT curators into the UniProt Protein2GO curation tool. http://www.geneontology.org/GO.refgenome.shtml""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2183 ; owl:annotatedTarget "GO central" . [] oboInOwl:hasDbXref "PMID:11125103", "RESID:AA0044" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0128 ; owl:annotatedTarget """Residue modification. OBSOLETE remap to MOD:00053.""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2183 ; owl:annotatedTarget "GO_central" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2183 ; owl:annotatedTarget "The Reference Genome Annotation Project" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2183 ; owl:annotatedTarget "go_central" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2184 ; owl:annotatedTarget "MTBBASE" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2184 ; owl:annotatedTarget "mtbbase" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2185 ; owl:annotatedTarget "Parkinson-UCL" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2185 ; owl:annotatedTarget "Parkinsons Disease Gene Ontology Initiative" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2185 ; owl:annotatedTarget "ParkinsonsUK-UCL" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2185 ; owl:annotatedTarget "parkinsonsuk-ucl" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2186 ; owl:annotatedTarget "Alzheimers Project at University of Toronto" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0128 ; owl:annotatedTarget "(S)-2-(acetylamino)pentanedioic acid" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2186 ; owl:annotatedTarget "Alzheimers University of Toronto" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2186 ; owl:annotatedTarget "Alzheimers_University_of_Toronto" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2186 ; owl:annotatedTarget "alut" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2187 ; owl:annotatedTarget "RI" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2187 ; owl:annotatedTarget "Roslin Institute" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2187 ; owl:annotatedTarget "Roslin_Institute" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2187 ; owl:annotatedTarget "ri" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2187 ; owl:annotatedTarget "roslin_institute" . [] oboInOwl:hasDbXref "PMID:20371350", "PMID:20644507" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2188 ; owl:annotatedTarget """Photoactivatable-Ribonucleoside-Enhanced Crosslinking and Immunoprecipitation (PAR-CLIP) is a biochemical method used for identifying the binding sites of cellular RNA-binding proteins (RBPs) and microRNA-containing ribonucleoprotein complexes (miRNPs). The method relies on the incorporation of photoreactive ribonucleoside analogs, such as 4-thiouridine (4-SU) and 6-thioguanosine (6-SG) into nascent RNA transcripts by living cells. Irradiation of the cells by UV light of 365 nm induces efficient crosslinking of photoreactive nucleoside-labeled cellular RNAs to interacting RBPs. Immunoprecipitation of the RBP of interest is followed by isolation of the crosslinked and coimmunoprecipitated RNA. The isolated RNA is converted into a cDNA library and deep sequenced using next-generation sequencing technology. http://en.wikipedia.org/wiki/PAR-CLIP""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2188 ; owl:annotatedTarget "PAR-CLIP" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0128 ; owl:annotatedTarget "EAC" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2188 ; owl:annotatedTarget "Photoactivatable-Ribonucleoside-Enhanced Crosslinking and Immunoprecipitation" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2188 ; owl:annotatedTarget "par-clip" . [] oboInOwl:hasDbXref "pmid:22414956" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2189 ; owl:annotatedTarget "Low-affinity interaction detection method designed specifically to detect interactions between extracellular proteins. Recombinant soluble fragments of these proteins are produced in a (generally) mammalian expression cell line and secreted into the medium and produced in two forms: a biotinylated bait which can be captured on a streptavidin-coated solid phase suitable for screening, and a pentamerised enzyme-tagged (beta-lactamase) prey. The bait and prey proteins are presented to each other in a binary fashion to detect direct interactions between them, similar to a conventional ELISA. The pentamerisation of the proteins in the prey is achieved through a peptide sequence from the cartilage oligomeric matrix protein (COMP) and increases the local concentration of the ectodomains thereby providing significant avidity gains to enable even very transient interactions to be detected. By normalising the activities of both the bait and prey to predetermined levels prior to screening, interactions having monomeric half-lives of 0.1 sec can be detected with low false positive rates." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2189 ; owl:annotatedTarget "AVidity-based EXtracellular Interaction Screen" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2189 ; owl:annotatedTarget "avexis" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2189 ; owl:annotatedTarget "avidity-based extracellular interaction screen" . [] oboInOwl:hasDbXref "PMID:23750541" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2190 ; owl:annotatedTarget "Non-protein coding transcripts longer than 200 nucleotides and that can be involved in a number of functions, like transcription, post-translational and epigenetic regulation. Most lncRNAs do not have a known function so far." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2190 ; owl:annotatedTarget "lncRNA" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2190 ; owl:annotatedTarget "lncrna" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2190 ; owl:annotatedTarget "long non coding RNA" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0128 ; owl:annotatedTarget "N-acetyl-L-glutamic acid" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2190 ; owl:annotatedTarget "long non coding ribonucleic acid" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2190 ; owl:annotatedTarget "long non-coding RNA" . [] oboInOwl:hasDbXref "PMID:14615540" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2191 ; owl:annotatedTarget """Combination of cross-linking and co-immunoprecipitation aimed to find protein-RNA interactions. The canonical method uses first a cross-linking procedure over a tissue sample or lysate, and the immunoprecipitated with specific antibodies for the protein of interest. Unspecific proteins are digested via proteinase K treatment. RNA can be then identified via Northern blotting or using RT-PCR and then sequencing of the generated cDNA. https://en.wikipedia.org/wiki/CLIP""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2191 ; owl:annotatedTarget "CLIP" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2191 ; owl:annotatedTarget "clip" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2191 ; owl:annotatedTarget "cross linking immunoprecipitation" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2191 ; owl:annotatedTarget "cross-linking immunoprecipitation" . [] oboInOwl:hasDbXref "PMID:18978773", "PMID:21633356" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2192 ; owl:annotatedTarget """This method combines UV cross-linking and immunoprecipitation with high-throughput sequencing to identify binding sites of RNA-binding proteins. https://en.wikipedia.org/wiki/HITS-CLIP""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2192 ; owl:annotatedTarget "CLIP-Seq" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2192 ; owl:annotatedTarget "HITS-CLIP" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0001 ; owl:annotatedTarget "Method to determine the interaction." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0014 ; owl:annotatedTarget "adenylate cyclase" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0128 ; owl:annotatedTarget "[E:ac]" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2192 ; owl:annotatedTarget "UV cross-linking immunoprecipitation combined with high-throughput sequencing" . [] oboInOwl:hasSynonymType mi:PSI-MOD-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2192 ; owl:annotatedTarget "clip-seq" . [] oboInOwl:hasDbXref "PMID:20601959" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2193 ; owl:annotatedTarget """iCLIP allows for the stringent purification of UV cross-linked protein-RNA complexes, using immunoprecipitation followed by SDS-PAGE and membrane transfer. The radiolabelled protein-RNA complexes are then excised from the membrane, and treated with proteinase to release the RNA. This leaves one or two amino acids at the RNA cross-link site. The RNA is then reverse transcribed using barcoded primers. Because reverse transcription stops prematurely at the cross-link site, iCLIP allows RNA-protein interaction sites to be identified at high resolution. https://en.wikipedia.org/wiki/ICLIP""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2193 ; owl:annotatedTarget "iCLIP" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2193 ; owl:annotatedTarget "iclip" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2193 ; owl:annotatedTarget "individual-nucleotide resolution cross-linking and immunoprecipitation" . [] oboInOwl:hasDbXref "PMID:19482942" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2194 ; owl:annotatedTarget "Combination of UV cross-linking and affinity purification where the protein of interest bears a tag used for pull-down or immunoprecipitation. As in CLIP, unspecific proteins are digested via proteinase K treatment and RNAs are tagged with oligonucleotide linkers. RNA can be then identified via Northern blotting or using RT-PCR and then sequencing of the generated cDNA." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2194 ; owl:annotatedTarget "CRAC" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2194 ; owl:annotatedTarget "crac" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2194 ; owl:annotatedTarget "cross-linking and analysis of cDNAs" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0128 ; owl:annotatedTarget "acetylglutamate" . [] oboInOwl:hasDbXref "PMID:21610164" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2195 ; owl:annotatedTarget "This method is a variation of CRAC where after combined cross-linking and affinity purification of protein-RNA complexes, RNA-RNA interactions are specifically detected. Base-paired RNA molecules can be linked together while tagging RNA with oligonucleotides, generating chimeric RNAs that allow identification of RNA-RNA pairs." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2195 ; owl:annotatedTarget "CLASH" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2195 ; owl:annotatedTarget "clash" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2195 ; owl:annotatedTarget "cross-linking, ligation, and sequencing of hybrids" . [] oboInOwl:hasDbXref "PMID:23504432" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2196 ; owl:annotatedTarget "A method that monitors ligand binding by measuring the change in frequency of a quartz crystal resonator resulting from the addition or removal of a small mass of a ligand specifically binding at the surface of the resonator." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2196 ; owl:annotatedTarget "QCM" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2196 ; owl:annotatedTarget "qcm" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2197 ; owl:annotatedTarget "An assay that uses molecular probes, such as ions, small molecules or antibodies to monitor interactions between biomolecules under study." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2197 ; owl:annotatedTarget "probe interaction assay" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2198 ; owl:annotatedTarget "The interaction is inferred from the effect it exerts on specific chemical labelling of one of the interacting partners." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0128 ; owl:annotatedTarget "acetylglutamic acid" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2198 ; owl:annotatedTarget "labelling assay" . [] oboInOwl:hasDbXref "PMID:8441405" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2199 ; owl:annotatedTarget "The interaction is detected through selective, chemical blockage of a specific site -which can be an active site- that becomes inaccessible once the participants are interacting. The interaction is detected through loss of signal of the chemical label" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2199 ; owl:annotatedTarget "site-labelling technology" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2199 ; owl:annotatedTarget "specific site-labelling technology" . [] oboInOwl:hasDbXref "PMID:22453911" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2200 ; owl:annotatedTarget """PRIMESDB is a systems biology platform that is developed to enable the collection, integration and analysis of state-of-the-art genomics, proteomics and mathematical modelling data being generated by the PRIMES project. PRIMES iinvestigates the role of protein interaction machines in oncogenic signalling with a particular focus on the EGFR network. PRIMESDB provides a centralised knowledgebase and analysis platform for cancer protein interaction networks. http://primesdb.eu/""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2200 ; owl:annotatedTarget "PRIMESDB" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2200 ; owl:annotatedTarget "primesdb" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2201 ; owl:annotatedTarget "Chemical alterations occurring at the nucleotide level in the specific DNA molecule involved in an interaction. The process can involve covalent modifications (i.e. methylations) or other forms of chemical modification." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2201 ; owl:annotatedTarget "DNA chemical modification" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2201 ; owl:annotatedTarget "DNA epigenetic modification" . [] oboInOwl:hasDbXref "PMID:11125103", "RESID:AA0046" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0129 ; owl:annotatedTarget """Residue modification. OBSOLETE remap to MOD:00055.""" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2201 ; owl:annotatedTarget "dna chemical modification" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2202 ; owl:annotatedTarget "Chemical alterations occurring at the nucleotide level in the specific RNA molecule involved in an interaction. The process can involve covalent modifications (i.e. 2'-O-methylation) or other forms of chemical modification, such as isomerizations (i.e. pseudouridylation)." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2202 ; owl:annotatedTarget "RNA chemical modification" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2202 ; owl:annotatedTarget "post-transcriptional modification" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2202 ; owl:annotatedTarget "rna chemical modification" . [] oboInOwl:hasDbXref "PMID:23378648" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2203 ; owl:annotatedTarget "Primer extension can be used to determine the 3' end of a given sequence of RNA. This technique requires a radiolabelled primer which is complementary to a region near the 3' end of the RNA. The primer is allowed to anneal to the RNA and reverse transcriptase is used to synthesize a strand of DNA from the RNA until it reaches the 5' end of the RNA. By denaturing the hybrid and using the extended primer DNA strand as a marker on an electrophoretic gel, it is possible to determine the transcriptional start site." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2203 ; owl:annotatedTarget "primer extension assay" . [] oboInOwl:hasDbXref "PMID:14744438" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2204 ; owl:annotatedTarget "A micro RNA (abbreviated miRNA) is a small non-coding RNA molecule (containing about 22 nucleotides) found in plants, animals, and some viruses, which functions in RNA silencing and post-transcriptional regulation of gene expression." . [] a owl:Axiom ; rdfs:label "https://en.wikipedia.org/wiki/MicroRNA" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_2204 ; owl:annotatedTarget "url:" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2204 ; owl:annotatedTarget "miRNA" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0129 ; owl:annotatedTarget "2-(acetylamino)ethanoic acid" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2204 ; owl:annotatedTarget "micro RNA" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2204 ; owl:annotatedTarget "micro-RNA" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2204 ; owl:annotatedTarget "micro-rna" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2204 ; owl:annotatedTarget "mirna" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2205 ; owl:annotatedTarget "PIR" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2205 ; owl:annotatedTarget "Protein Information Resource" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2205 ; owl:annotatedTarget "pir" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2206 ; owl:annotatedTarget "Chemical modification observed on a nucleic acid molecule in the context of an interaction. Modifications involving full nucleotide substitutions/deletions are excluded from this definition." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2206 ; owl:annotatedTarget "observed na chemical modification" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2206 ; owl:annotatedTarget "observed nucleic acid chemical modification" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0129 ; owl:annotatedTarget "GAC" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2207 ; owl:annotatedTarget "Chemical modification observed on an RNA molecule resulting subsequently of an interaction. Modifications involving full nucleotide substitutions/deletions are excluded from this definition." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2207 ; owl:annotatedTarget "resulting na chemical modification" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2207 ; owl:annotatedTarget "resulting nucleic acid chemical modification" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2208 ; owl:annotatedTarget "Chemical modification observed on a nucleic acid molecule required for an interaction to occur. Modifications involving full nucleotide substitutions/deletions are excluded from this definition." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2208 ; owl:annotatedTarget "prerequisite-na chemical modification" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2208 ; owl:annotatedTarget "prerequisite-nucleic acid chemical modification" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2209 ; owl:annotatedTarget "Chemical modification observed on a nucleic acid molecule observed to decrease the strength or rate of an interaction. Modifications involving full nucleotide substitutions/deletions are excluded from this definition." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2209 ; owl:annotatedTarget "na chemical modification decreasing" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2209 ; owl:annotatedTarget "nucleic acid chemical modification decreasing an interaction" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2210 ; owl:annotatedTarget "Chemical modification observed on a nucleic acid molecule observed to disrupt an interaction. Modifications involving full nucleotide substitutions/deletions are excluded from this definition." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0129 ; owl:annotatedTarget "N-acetylglycine" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2210 ; owl:annotatedTarget "na chemical modification disrupting" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2210 ; owl:annotatedTarget "nucleic acid chemical modification disrupting an interaction" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2211 ; owl:annotatedTarget "Chemical modification observed on a nucleic acid molecule observed to increase the strength or rate of an interaction. Modifications involving full nucleotide substitutions/deletions are excluded from this definition." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2211 ; owl:annotatedTarget "na chemical modification increasing" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2211 ; owl:annotatedTarget "nucleic acid chemical modification increasing an interaction" . [] oboInOwl:hasDbXref "PMID:25047258" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2212 ; owl:annotatedTarget """The ProteomeXchange consortium was set up to provide a single point of submission of MS proteomics data to the main existing proteomics repositories, and to encourage the data exchange between them for optimal data dissemination. The data is actually hosted by consortium member databases like PeptideAtlas or PRIDE. http://www.proteomexchange.org""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2212 ; owl:annotatedTarget "ProteomExchange" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2212 ; owl:annotatedTarget "proteomexchange" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2213 ; owl:annotatedTarget "Super-resolution microscopy is a form of light microscopy that allows images to be taken with a higher resolution than the diffraction limit. Several different methods can be used to achieve beyond-diffraction limit resolution and these can be broadly divided in two categories: \"true\" super-resolution techniques, which capture information contained in evanescent waves, and \"functional\" super-resolution techniques, which use clever experimental techniques and known limitations on the matter being imaged to reconstruct a super-resolution image." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2213 ; owl:annotatedTarget "super resolution microscopy" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0129 ; owl:annotatedTarget "[G:ac]" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2213 ; owl:annotatedTarget "super-resolution microscopy" . [] oboInOwl:hasDbXref "PMID:26467481" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2214 ; owl:annotatedTarget "SIGNOR, the SIGnaling Network Open Resource, organizes and stores in a structured format signaling information published in the scientific literature. The captured information is stored as binary causative relationships between biological entities and can be represented graphically as activity flow. The signaling information is mapped to the human proteome even if the experimental evidence is based on experiments on mammalian model organisms." . [] a owl:Axiom ; rdfs:label "http://signor.uniroma2.it/relation_result.php?id=${ac}" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_2214 ; owl:annotatedTarget "search-url:" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2214 ; owl:annotatedTarget "SIGNOR" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2214 ; owl:annotatedTarget "SIGnaling Network Open Resource" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2214 ; owl:annotatedTarget "signaling network open resource" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2214 ; owl:annotatedTarget "signor" . [] oboInOwl:hasDbXref "PMID:27107012" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2215 ; owl:annotatedTarget "This method allows screening of a full matrix of protein pairs in a single multiplexed strain pool. A doubly engineered clone pool is prepared so that each clone bears two distinct DNA barcodes flanked by site specific recombination sequences. Positive bait-prey combinations allow activation of reporter genes and their respective barcodes undergo recombination, creating unique barcode combinations. Recombined barcode tags are then fused, extracted and sequenced for identification of interacting pairs." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2215 ; owl:annotatedTarget "BGF-2h" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2215 ; owl:annotatedTarget "barcode fusion genetics two hybrid" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0129 ; owl:annotatedTarget "aceturic acid" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2215 ; owl:annotatedTarget "bfg two hybrid" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2215 ; owl:annotatedTarget "bfg-2h" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2216 ; owl:annotatedTarget """Measurement of de-AMPylation, the removal of a phosphodiester or phosphoramide ester of AMP from Tyr (RESID:AA0203), Lys (RESID:AA0227), Thr (RESID:AA0267), His (RESID:AA0371) and other amino acids.""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2216 ; owl:annotatedTarget "de-AMPylation assay" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2216 ; owl:annotatedTarget "de-ampylation assay" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2216 ; owl:annotatedTarget "deAMPylation assay" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2216 ; owl:annotatedTarget "deampylation assay" . [] oboInOwl:hasDbXref "PMID:22070901" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2217 ; owl:annotatedTarget "The c-terminus of a luciferase protein, fused to a protein of interest for use in the split luciferase complementation assay." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2217 ; owl:annotatedTarget "luciferase-c" . [] oboInOwl:hasDbXref "PMID:22070901" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2218 ; owl:annotatedTarget "The n-terminus of a luciferase protein, fused to a protein of interest for use in the split luciferase complementation assay." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0129 ; owl:annotatedTarget "acetylglycine" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2218 ; owl:annotatedTarget "luciferase-n" . [] oboInOwl:hasDbXref "PMID:26025768" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2219 ; owl:annotatedTarget "Gaussia luciferase, is an enzyme from the crustacean Gaussia princeps catalyzing the oxidation of coelenterazine to coelenteramide that produces light. Gaussia luciferase produces a blue light around the 480 nm range." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2219 ; owl:annotatedTarget "GLuc tag" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2219 ; owl:annotatedTarget "gaussia luciferase" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2219 ; owl:annotatedTarget "gaussia luciferase protein tag" . [] oboInOwl:hasSynonymType mi:PSI-MOD-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2219 ; owl:annotatedTarget "gluc tag" . [] oboInOwl:hasDbXref "PMID:17099704" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2220 ; owl:annotatedTarget "The c-terminus of the gaussia luciferase protein, fused to a protein of interest for use in the split luciferase complementation assay." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2220 ; owl:annotatedTarget "gaussia-c" . [] oboInOwl:hasDbXref "PMID:17099704" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2221 ; owl:annotatedTarget "The n-terminus of the gaussia luciferase protein, fused to a protein of interest for use in the split luciferase complementation assay." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2221 ; owl:annotatedTarget "gaussia-n" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0014 ; owl:annotatedTarget "bacterial two-hybrid" . [] oboInOwl:hasDbXref "PMID:11125103" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0130 ; owl:annotatedTarget """Residue modification. OBSOLETE remap to MOD:00781.""" . [] oboInOwl:hasDbXref "PMID:16429126" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2222 ; owl:annotatedTarget "Socio-affinity index provides a single measure of the association between each pair of proteins based on an entire AP-MS dataset, considering both the spoke (when one protein retrieves another when tagged) and the matrix (when two proteins are retrieved by another) evidence, and the overall frequency of each protein in the data set." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2222 ; owl:annotatedTarget "inference by socio-affinity scoring" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2222 ; owl:annotatedTarget "socio-affinity index inference" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2222 ; owl:annotatedTarget "socio-affinity inference" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2222 ; owl:annotatedTarget "socioaffinity index scoring" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2222 ; owl:annotatedTarget "socioaffinity inference" . [] oboInOwl:hasDbXref "PMID:27099342" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2223 ; owl:annotatedTarget "This method measures co-purification of proteins through several orthogonal purification steps, deriving a set of correlation measures that are then computationally weighted and combined to infer interacting pairs." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2223 ; owl:annotatedTarget "inference by quantitative co-purification" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2223 ; owl:annotatedTarget "quantitative tagless co - purification" . [] oboInOwl:hasDbXref "PMID:10024243" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2224 ; owl:annotatedTarget "In this method predicted RNA-RNA pairings are tested by knocking down one of the two interacting RNAs and then experimentally determine if its presence is required for the other to be chemically modified." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0130 ; owl:annotatedTarget "HAC" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2224 ; owl:annotatedTarget "chemical rna modification plus base pairing prediction" . [] oboInOwl:hasDbXref "PMID:26479676" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2225 ; owl:annotatedTarget """ZINC is a database of commercially available compounds for virtual screening. It uses publicly available bioactivity data to allow investigators to access chemical tools for biology. http://zinc15.docking.org/""" . [] a owl:Axiom ; rdfs:label "[0-9]*" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_2225 ; owl:annotatedTarget "id-validation-regexp:" . [] a owl:Axiom ; rdfs:label "http://zinc15.docking.org/substances/${ac}" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_2225 ; owl:annotatedTarget "search-url:" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2225 ; owl:annotatedTarget "ZINC" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2225 ; owl:annotatedTarget "zinc" . [] oboInOwl:hasDbXref "PMID:14577292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2226 ; owl:annotatedTarget "A change in a sequence or structure in comparison to a reference entity due to a insertion, deletion or substitution event that does not have any effect over an interaction when compared with the wild-type." . [] oboInOwl:hasSynonymType mi:PSI-MOD-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2226 ; owl:annotatedTarget "mutation not affecting interaction" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2226 ; owl:annotatedTarget "mutation with no effect" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2227 ; owl:annotatedTarget "A change in a sequence or structure in comparison to a reference entity due to a insertion, deletion or substitution event that enables an interaction when compared with the wild-type, which does not interact." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0130 ; owl:annotatedTarget "N-acetyl-L-histidine" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2227 ; owl:annotatedTarget "mutation causing" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2227 ; owl:annotatedTarget "mutation causing an interaction" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2227 ; owl:annotatedTarget "mutation enabling interaction" . [] a owl:Axiom ; rdfs:label "www.ceitec.eu/" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_2228 ; owl:annotatedTarget "search-url:" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2228 ; owl:annotatedTarget "CEITEC" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2228 ; owl:annotatedTarget "Central European Institute of Technology" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2228 ; owl:annotatedTarget "ceitec" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2229 ; owl:annotatedTarget "Interaction between a nucleic acid and a gene region." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2230 ; owl:annotatedTarget "Interaction between a nucleic acid and a corresponding nucleic acid." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2231 ; owl:annotatedTarget "co-expression" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0130 ; owl:annotatedTarget "[H:ac]" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2231 ; owl:annotatedTarget "coexpression" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2231 ; owl:annotatedTarget "coexpression prediction" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2232 ; owl:annotatedTarget "molecular association" . [] oboInOwl:hasDbXref "DOI:10.1142/S0219525908001465" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2233 ; owl:annotatedTarget "Binary causative relationships between biological entities. CV terms belonging to this term allow the description of causal interactions using the current PSI-MI schema." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2233 ; owl:annotatedTarget "causal interaction" . [] oboInOwl:hasDbXref "PMID:26467481" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2234 ; owl:annotatedTarget "The effect of modulator entity A on a modulated entity B." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2234 ; owl:annotatedTarget "causal statement" . [] oboInOwl:hasDbXref "PMID:26467481" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2235 ; owl:annotatedTarget "The effect of a modulator entity A on a modulated entity B that increases the concentration and/or frequency and/or rate and/or extent of the molecular function of B." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2235 ; owl:annotatedTarget "up regulates" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2235 ; owl:annotatedTarget "up-regulates" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0130 ; owl:annotatedTarget "acetylhistidine" . [] oboInOwl:hasDbXref "PMID:26467481" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2236 ; owl:annotatedTarget "The effect of a modulator entity A on a modulated entity B that increases the frequency, rate or extent of the molecular function of B, an elemental biological activity occurring at the molecular level, such as catalysis or binding (GO:0044093)." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2236 ; owl:annotatedTarget "activates activity" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2236 ; owl:annotatedTarget "up-regulates activity" . [] oboInOwl:hasDbXref "PMID:26467481" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2237 ; owl:annotatedTarget "The effect of a modulator entity A on a modulated entity B that increases the concentration of the modulated entity B." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2237 ; owl:annotatedTarget "increases quantity" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2237 ; owl:annotatedTarget "up-regulates quantity" . [] oboInOwl:hasDbXref "PMID:26467481" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2238 ; owl:annotatedTarget "The effect of a modulator entity A on a modulated entity B that increases the concentration of the modulated entity B, by promoting its gene expression." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2238 ; owl:annotatedTarget "increases quantity by expression" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2238 ; owl:annotatedTarget "up-regulates quantity by expression" . [] oboInOwl:hasDbXref "PMID:26467481" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2239 ; owl:annotatedTarget "The effect of a modulator entity A on a modulated entity B that increases the concentration of the modulated entity B by preventing its degradation." . [] oboInOwl:hasDbXref "PMID:11125103", "RESID:AA0047" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0131 ; owl:annotatedTarget """Residue modification. OBSOLETE remap to MOD:00056.""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2239 ; owl:annotatedTarget "increases quantity by stabilization" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2239 ; owl:annotatedTarget "up-regulates quantity by stabilization" . [] oboInOwl:hasDbXref "PMID:26467481" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2240 ; owl:annotatedTarget "The effect of a modulator entity A on a modulated entity B that decreases the concentration and/or frequency and/or ate and/or extent of molecular function of B." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2240 ; owl:annotatedTarget "down regulates" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2240 ; owl:annotatedTarget "down-regulates" . [] oboInOwl:hasDbXref "PMID:26467481" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2241 ; owl:annotatedTarget "The effect of a modulator entity A on a modulated entity B that decreases the frequency, rate or extent of the molecular function of B, an elemental biological activity occurring at the molecular level, such as catalysis or binding (GO:0044093)." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2241 ; owl:annotatedTarget "down-regulates activity" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2241 ; owl:annotatedTarget "inhibits activity" . [] oboInOwl:hasDbXref "PMID:26467481" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2242 ; owl:annotatedTarget "The effect of a modulator entity A on a modulated entity B that decreases the concentration of the modulated entity B." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2242 ; owl:annotatedTarget "decreases quantity" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0131 ; owl:annotatedTarget "(2S,3S)-2-acetylamino-3-methylpentanoic acid" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2242 ; owl:annotatedTarget "down-regulates quantity" . [] oboInOwl:hasDbXref "PMID:26467481" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2243 ; owl:annotatedTarget "The effect of a modulator entity A on a modulated entity B that decreases the concentration of the modulated entity B, by preventing its gene expression." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2243 ; owl:annotatedTarget "Decrease quantity by repression" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2243 ; owl:annotatedTarget "down-regulates quantity by repression" . [] oboInOwl:hasDbXref "PMID:26467481" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2244 ; owl:annotatedTarget "The effect of a modulator entity A on a modulated entity B that decreases the concentration of the modulated entity B by promoting its degradation." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2244 ; owl:annotatedTarget "decrease quantity by destabilization" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2244 ; owl:annotatedTarget "down-regulates quantity by destabilization" . [] oboInOwl:hasDbXref "PMID:26467481" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2245 ; owl:annotatedTarget "Type of relationship between entities involved in a causal interaction. This term is to be used only to describe the effect of a modulator entity A on a modulated entity B when A is not immediately upstream of B." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2245 ; owl:annotatedTarget "causal regulatory mechanism" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2245 ; owl:annotatedTarget "indirect causal regulation" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0131 ; owl:annotatedTarget "IAC" . [] oboInOwl:hasDbXref "PMID:15845847" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2246 ; owl:annotatedTarget "The effect of a modulator entity A on a modulated entity B that occurs when A is not immediately upstream of B." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2246 ; owl:annotatedTarget "indirect" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2246 ; owl:annotatedTarget "indirect causal regulation" . [] oboInOwl:hasDbXref "PMID:25428369" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2247 ; owl:annotatedTarget "Any process that modulates the frequency, rate or extent of the chemical reactions resulting in the transcription of DNA to RNA and gene activity regulation." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2247 ; owl:annotatedTarget "transcriptional regulation" . [] oboInOwl:hasDbXref "PMID:25428369" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2248 ; owl:annotatedTarget "Any process that modulates the frequency, rate or extent of the chemical reactions and pathways resulting in the formation of proteins by the translation of mRNA." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2248 ; owl:annotatedTarget "translation regulation" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2248 ; owl:annotatedTarget "translational regulation" . [] oboInOwl:hasDbXref "PMID:25428369" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2249 ; owl:annotatedTarget "Any process that control gene expression at the RNA level, between the transcription and the translation of the gene." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2249 ; owl:annotatedTarget "post transcriptional regulation" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0131 ; owl:annotatedTarget "N-acetyl-L-isoleucine" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2249 ; owl:annotatedTarget "post-transcriptional regulation" . [] oboInOwl:hasDbXref "PMID:15845847" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2250 ; owl:annotatedTarget "The effect of a modulator entity A on a modulated entity B that occurs when A is immediately upstream of B." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2250 ; owl:annotatedTarget "direct" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2250 ; owl:annotatedTarget "direct causal regulation" . [] oboInOwl:hasDbXref "PMID:25428369" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2251 ; owl:annotatedTarget "Direct binding of a DbTF to a DNA regulatory sequence that modulates the frequency, rate or extent of the chemical reactions resulting in the transcription of DNA to RNA and gene activity regulation." . [] oboInOwl:hasDbXref "PMID:23303910" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2252 ; owl:annotatedTarget "The process mediated by guanine nucleotide exchange factors (GEFs) that catalyze the exchange of bound GDP with cytosolic GTP." . [] oboInOwl:hasSynonymType mi:PSI-MOD-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2252 ; owl:annotatedTarget "GEF reaction" . [] oboInOwl:hasDbXref "PMID:17173929" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2253 ; owl:annotatedTarget "A family of cellular proteins able to increases the activity of a GTPase." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2253 ; owl:annotatedTarget "GAP reaction" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2253 ; owl:annotatedTarget "GTPase-Accelerating Protein reaction" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0131 ; owl:annotatedTarget "[I:ac]" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2253 ; owl:annotatedTarget "RGS protein reaction" . [] oboInOwl:hasDbXref "PMID:26467481" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2254 ; owl:annotatedTarget "The effect of a chemical compound that results in the activation or in an increased activation of a target molecule." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2254 ; owl:annotatedTarget "chemical activation reaction" . [] oboInOwl:hasDbXref "PMID:26467481" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2255 ; owl:annotatedTarget "The effect of a chemical compound that stops, prevents, or reduces the activity of a target molecule." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2255 ; owl:annotatedTarget "chemical inhibition reaction" . [] oboInOwl:hasDbXref "PMID:26467481" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2256 ; owl:annotatedTarget "Any process that modulates the frequency, rate or extent of any process in which a cell, a substance, or a cellular entity is transported to, or maintained in, a specific location." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2256 ; owl:annotatedTarget "relocalization" . [] oboInOwl:hasDbXref "PMID:26467481" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2257 ; owl:annotatedTarget "The chemical reactions and pathways resulting in the formation, breakdown, modification of small molecules." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2257 ; owl:annotatedTarget "small molecule catalysis reaction" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2258 ; owl:annotatedTarget "Molecule that encompasses any constitutionally or isotopically distinct atom, molecule, ion, ion pair, radical, radical ion, complex, conformer, etc., identifiable as a separately distinguishable entity, which is not physiologically part of a cell, tissue, organ, or organism." . [] oboInOwl:hasDbXref "PMID:11578931" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0016 ; owl:annotatedTarget "Circular dichroism (CD) is observed when optically active molecules absorb left and right hand circularly polarized light slightly differently. Linearly polarized light can be viewed as a superposition of two components of circularly polarized light of equal amplitude and phase but opposite handness. When this light passes through an optically active sample the two polarized components are absorbed differently. The difference in left and right handed absorbance A(l)- A(r) is the signal registered in CD spectra. This signal displays distinct features corresponding to different secondary structures present in peptides, proteins and nucleic acids. The analysis of CD spectra can therefore yield valuable information about the secondary structure of biological macromolecules and the interactions among molecules that influence their structure." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0131 ; owl:annotatedTarget "acetylisoleucine" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2258 ; owl:annotatedTarget "chemical" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2258 ; owl:annotatedTarget "drug" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2258 ; owl:annotatedTarget "xenobiotic" . [] oboInOwl:hasDbXref "PMID:26467481" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2259 ; owl:annotatedTarget "Entity involved in a causative relationship. These terms have to be used as interactor types only if associated with causal statements." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2259 ; owl:annotatedTarget "causal interactor type" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2260 ; owl:annotatedTarget "Any detectable change in the internal or external environment of a cell, tissue, organ, or organism." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2260 ; owl:annotatedTarget "stimulus" . [] oboInOwl:hasDbXref "PMID:19380745" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2261 ; owl:annotatedTarget "Cellular phenotype is the conglomerate of multiple cellular processes involving gene and protein expression that result in the elaboration of a cell's particular morphology and function." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2261 ; owl:annotatedTarget "phenotype" . [] oboInOwl:hasDbXref "PMID:26467481" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2262 ; owl:annotatedTarget "The modification of a subsequence that regulates the concentration and/or frequency and/or rate and/or extent of the molecular function of an entity." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0131 ; owl:annotatedTarget "acetylisoleucine" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2262 ; owl:annotatedTarget "causal regulatory modification" . [] oboInOwl:hasDbXref "PMID:15688001" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2263 ; owl:annotatedTarget "Reaction that create a covalent bond between a nitrogen monoxide group and the thiol group of cysteine." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2263 ; owl:annotatedTarget "s-nitrosylation" . [] oboInOwl:hasDbXref "PMID:26467481" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2264 ; owl:annotatedTarget "A protein modification that effectively add a tyrosine residues to the c-terminal end of alpha-tubulin." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2264 ; owl:annotatedTarget "tyrosinated residue" . [] oboInOwl:hasDbXref "PMID:26467481" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2265 ; owl:annotatedTarget "A protein modification that effectively remove an acyl group from a protein." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2265 ; owl:annotatedTarget "de-acetylated residue" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2265 ; owl:annotatedTarget "deacetylated residue" . [] oboInOwl:hasDbXref "PMID:26467481" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2266 ; owl:annotatedTarget "A protein modification that effectively remove a phosphate group from a protein by hydrolysis." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2266 ; owl:annotatedTarget "de-phosphorylated residue" . [] oboInOwl:hasDbXref "PMID:11125103" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0132 ; owl:annotatedTarget """Residue modification. OBSOLETE remap to MOD:00782.""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2266 ; owl:annotatedTarget "dephosphorylated residue" . [] oboInOwl:hasDbXref "PMID:26467481" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2267 ; owl:annotatedTarget "A protein modification that effectively cleaves the G-K bond and releases SUMO proteins." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2267 ; owl:annotatedTarget "de-sumoylated residue" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2267 ; owl:annotatedTarget "desumoylated residue" . [] oboInOwl:hasDbXref "PMID:26467481" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2268 ; owl:annotatedTarget "A protein modification that effectively removes one or more methyl groups from a protein." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2268 ; owl:annotatedTarget "de-methylated residue" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2268 ; owl:annotatedTarget "demethylated residue" . [] oboInOwl:hasDbXref "PMID:26467481" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2269 ; owl:annotatedTarget "A protein modification that effectively cleaves the G-K bond and releases ubiquitin or ubiquitin like proteins." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2269 ; owl:annotatedTarget "de-ubiquitinylated residue" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2269 ; owl:annotatedTarget "deubiquitinylated residue" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0132 ; owl:annotatedTarget "LAC" . [] oboInOwl:hasDbXref "PMID:23331499" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2270 ; owl:annotatedTarget """SignaLink 2.0 is a signaling pathway resource with multi-layered regulatory networks. http://signalink.org""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2270 ; owl:annotatedTarget "SignaLink" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2270 ; owl:annotatedTarget "signalink" . [] oboInOwl:hasDbXref "PMID:23479348" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2271 ; owl:annotatedTarget """EDAM (EMBRACE Data And Methods) is an ontology of bioinformatics operations (tool, application, or workflow functions), types of data, topics (application domains), and data formats. http://edamontology.org/""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2271 ; owl:annotatedTarget "EDAM" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2271 ; owl:annotatedTarget "EMBRACE Data And Methods" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2271 ; owl:annotatedTarget "edam" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2272 ; owl:annotatedTarget "tyrosinylation" . [] oboInOwl:hasDbXref "PMID:10842328" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2273 ; owl:annotatedTarget "Reversible reaction that add a tyrosine residues to the c-terminal end of alpha-tubulin." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2273 ; owl:annotatedTarget "tyrosination" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0132 ; owl:annotatedTarget "N-acetyl-L-leucine" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2274 ; owl:annotatedTarget "Entity whose activity exerts an effect on the concentration, frequency, rate or extent of the target entity." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2274 ; owl:annotatedTarget "modulator" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2274 ; owl:annotatedTarget "regulator" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2275 ; owl:annotatedTarget "Entity whose concentration, frequency, rate or extent are regulated by the regulator entity." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2275 ; owl:annotatedTarget "modulator target" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2275 ; owl:annotatedTarget "regulator target" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2276 ; owl:annotatedTarget "Chemical alterations occurring in the specific carbohydrate molecule involved in an interaction. The process can involve covalent modifications (i.e. sulfations) or other forms of chemical modification." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2276 ; owl:annotatedTarget "carbohydrate chemical modification" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2277 ; owl:annotatedTarget "Cre recombinase two hybrid" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2277 ; owl:annotatedTarget "cr-2h" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0132 ; owl:annotatedTarget "[L:ac]" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2277 ; owl:annotatedTarget "cr-two hybrid" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2278 ; owl:annotatedTarget "Length of a repetitive polymer chain. Applicable to carbohydrates and other non-protein, non-nucleic acid polymers." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2278 ; owl:annotatedTarget "polymer chain length" . [] oboInOwl:hasDbXref "PMID:25313161" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2279 ; owl:annotatedTarget "The Complex Portal is a manually curated, encyclopaedic resource of macromolecular complexes from a number of key model organisms, entered into the IntAct molecular interaction database . Data includes protein-only complexes as well as protein-small molecule and protein-nucleic acid complexes. All complexes are derived from physical molecular interaction evidences extracted from the literature and cross-referenced in the entry, or by curator inference from information on homologs in closely related species or by inference from scientific background. All complexes are tagged with Evidence and Conclusion Ontology codes to indicate the type of evidence available for each entry." . [] a owl:Axiom ; rdfs:label "http://www.ebi.ac.uk/complexportal/complex/${ac}" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_2279 ; owl:annotatedTarget "search-url:" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2279 ; owl:annotatedTarget "Complex Portal" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2279 ; owl:annotatedTarget "complex portal" . [] oboInOwl:hasDbXref "PMID:2703484", "PMID:3440704" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2280 ; owl:annotatedTarget "Reaction in which an amide functional group in the side chain of the amino acids asparagine or glutamine is removed or converted to another functional group. Typically, asparagine is converted to aspartic acid or isoaspartic acid and glutamine is converted to glutamic acid or pyroglutamic acid (5-oxoproline)." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2280 ; owl:annotatedTarget "deamidation" . [] oboInOwl:hasDbXref "GO:0004040" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2281 ; owl:annotatedTarget "Assay to measure the catalysis of the reaction: a monocarboxylic acid amide + H2O = a monocarboxylate + NH3." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0132 ; owl:annotatedTarget "acetylleucine" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2281 ; owl:annotatedTarget "amidase assay" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2281 ; owl:annotatedTarget "deamidation" . [] oboInOwl:hasDbXref "PMID:25313161" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2282 ; owl:annotatedTarget "Complex object unique primary identifier that is assigned to a complex in the Complex Portal." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2282 ; owl:annotatedTarget "complex-primary" . [] oboInOwl:hasDbXref "PMID:26404144" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2283 ; owl:annotatedTarget "Southwestern blotting, is a lab technique which involves identifying and characterizing DNA-binding proteins by their ability to bind to specific oligonucleotide probes, generally radioactively labeled. The proteins are separated by gel electrophoresis and are subsequently transferred to nitrocellulose membranes similar to other types of blotting." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2283 ; owl:annotatedTarget "southwestern blot" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2283 ; owl:annotatedTarget "southwestern blotting" . [] oboInOwl:hasDbXref "PMID:25313161" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2284 ; owl:annotatedTarget "Indicates that the cross-referenced molecule is a component of a containing complex." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2284 ; owl:annotatedTarget "complex component" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2284 ; owl:annotatedTarget "complex-component" . [] oboInOwl:hasDbXref "PMID:11125103", "RESID:AA0048" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0133 ; owl:annotatedTarget """Residue modification. OBSOLETE remap to MOD:00057.""" . [] oboInOwl:hasDbXref "PMID:14697198", "PMID:21431711" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2285 ; owl:annotatedTarget "The method is based on the functional effect of the binding of the microRNA on the target (mRNA or LncRNA), which is the repression of the expression of the target. To validate a sequence as a direct target of a microRNA, a luciferase reporter gene carrying the wt candidate sequence or its mutated form is used, and the expression of the target is evaluated with a luciferase assay. If the wt is significantly less expressed than the mutant, the binding occurs." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2285 ; owl:annotatedTarget "miRNA interference luciferase assay" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2286 ; owl:annotatedTarget "functional association" . [] oboInOwl:hasDbXref "PMID:7877166" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2287 ; owl:annotatedTarget """Identity of the participant was established (or confirmed) by fitting its molecular model to the experimentally determined electron density.""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2287 ; owl:annotatedTarget "identification by structure determination" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2287 ; owl:annotatedTarget "structure determination" . [] oboInOwl:hasDbXref "PMID:27203113" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2288 ; owl:annotatedTarget "DAP-seq is an in vitro TF-DNA binding assay in which a DAP-seq gDNA library is prepared by attaching a short DNA sequencing adaptor onto purified and fragmented gDNA. In a separate reaction, an affinity-purified TF is prepared by in vitro expression, bound to ligand-coupled beads, and washed to remove non-specific cellular components. The gDNA library is added to the affinity-bound TF and the unbound DNA is washed away. The bound fraction is eluted, amplified with PCR primers to introduce an indexed adaptor, and the DNA is sequenced." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2288 ; owl:annotatedTarget "DNA affinity purification sequencing" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2288 ; owl:annotatedTarget "dap-seq" . [] oboInOwl:hasDbXref "PMID:27122307" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2289 ; owl:annotatedTarget "The bait fused to a viral protein (e.g. HIV-1 GAG protein) allows the trapping of interaction partners (preys) within virus-like particles (VLPs) that bud from mammalian cells. Once the VLPs are enriched and purified, this technique allows the isolation of multimeric complexes as well as binary interactions and their subsequent identification by methods such as MS and western blots." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0133 ; owl:annotatedTarget "(S)-2-acetylamino-6-aminohexanoic acid" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2289 ; owl:annotatedTarget "viral particle co-purification" . [] oboInOwl:hasDbXref "PMID:17023539", "PMID:17081984" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2290 ; owl:annotatedTarget "Optical tweezers are instruments that use a focused laser beam to apply force to particles suspended in a liquid medium. This allows to measure forces generated between interacting molecules - either at the level of just single interacting pair of molecules or at the level of larger molecular assemblies." . [] oboInOwl:hasDbXref "PMID:18511917" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2291 ; owl:annotatedTarget "Molecules adsorbed on a solid surface are picked up by a microscopic tip (nanometers wide) that is located at the end of an elastic cantilever. Piezoelectric controller is used to measure forces generated by single molecules or molecular complexes stretched between the substrate and the cantilever tip." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2291 ; owl:annotatedTarget "afm cantilevers" . [] oboInOwl:hasDbXref "PMID:18511917" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2292 ; owl:annotatedTarget "Magnetic tweezers are instruments that use a set of magnets to apply forces to physically hold and move individual molecules attached to ferromagnetic beads. Such instruments allow to measure the forces generated between interacting molecules - either at the level of just single interacting pair of molecules or at the level of larger molecular assemblies." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2292 ; owl:annotatedTarget "electromagnetic tweezers" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2293 ; owl:annotatedTarget "Term describing the upstream end of a nucleotide sequence." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2294 ; owl:annotatedTarget "Term describing the upstream region of a nucleotide sequence, exact coordinates not available." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2295 ; owl:annotatedTarget "Term describing the downstream end of a nucleotide sequence." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2296 ; owl:annotatedTarget "Term describing the downstream region of a nucleotide sequence, exact coordinates not available." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0133 ; owl:annotatedTarget "KAC" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2297 ; owl:annotatedTarget "Chemical alterations occurring in the specific carbohydrate molecule involved in an interaction that enables an interaction when compared with the unaltered carbohydrate, which does not interact." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2297 ; owl:annotatedTarget "carbohydrate chemical modification causing" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2298 ; owl:annotatedTarget "Chemical alterations occurring in the specific carbohydrate molecule involved in an interaction that does not have any effect over an interaction when compared with the unaltered form." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2298 ; owl:annotatedTarget "carbohydrate chemical modification not affecting interaction" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2299 ; owl:annotatedTarget "Chemical alterations occurring in the specific carbohydrate molecule involved in an interaction that decreases significantly interaction strength or rate (in the case of interactions inferred from enzymatic reaction) when compared with the unaltered carbohydrate." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2299 ; owl:annotatedTarget "carbohydrate chemical modification decreasing" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2300 ; owl:annotatedTarget "Chemical alterations occurring in the specific carbohydrate molecule involved in an interaction that decreases significantly interaction rate (in the case of interactions inferred from enzymatic reaction) when compared with the unaltered carbohydrate." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2300 ; owl:annotatedTarget "carbohydrate chemical modification decreasing rate" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2301 ; owl:annotatedTarget "Chemical alterations occurring in the specific carbohydrate molecule involved in an interaction that decreases significantly interaction strength when compared with the unaltered carbohydrate." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2301 ; owl:annotatedTarget "carbohydrate chemical modification decreasing strength" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0016 ; owl:annotatedTarget "CD" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0133 ; owl:annotatedTarget "N2-acetyl-L-lysine" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2302 ; owl:annotatedTarget "Chemical alterations occurring in the specific carbohydrate molecule involved in an interaction that disrupts interaction strength or rate (in the case of interactions inferred from enzymatic reaction) when compared with the unaltered carbohydrate." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2302 ; owl:annotatedTarget "carbohydrate chemical modification disrupting" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2303 ; owl:annotatedTarget "Chemical alterations occurring in the specific carbohydrate molecule involved in an interaction that disrupts interaction strength when compared with the unaltered carbohydrate." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2303 ; owl:annotatedTarget "carbohydrate chemical modification disrupting strength" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2304 ; owl:annotatedTarget "Chemical alterations occurring in the specific carbohydrate molecule involved in an interaction that disrupts interaction rate (in the case of interactions inferred from enzymatic reaction) when compared with the unaltered carbohydrate." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2304 ; owl:annotatedTarget "carbohydrate chemical modification disrupting rate" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2305 ; owl:annotatedTarget "Chemical alterations occurring in the specific carbohydrate molecule involved in an interaction that increases significantly interaction strength or rate (in the case of interactions inferred from enzymatic reaction) when compared with the unaltered carbohydrate." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2305 ; owl:annotatedTarget "carbohydrate chemical modification increasing" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2306 ; owl:annotatedTarget "Chemical alterations occurring in the specific carbohydrate molecule involved in an interaction that increases significantly interaction strength when compared with the unaltered carbohydrate." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2306 ; owl:annotatedTarget "carbohydrate chemical modification increasing strength" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0133 ; owl:annotatedTarget "N2-acetyllysine" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2307 ; owl:annotatedTarget "Chemical alterations occurring in the specific carbohydrate molecule involved in an interaction that increases significantly interaction rate (in the case of interactions inferred from enzymatic reaction) when compared with the unaltered carbohydrate." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2307 ; owl:annotatedTarget "carbohydrate chemical modification increasing rate" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2308 ; owl:annotatedTarget "Carbohydrate species chemically attached to proteins, or other organic molecules." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2308 ; owl:annotatedTarget "attached glycan" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2308 ; owl:annotatedTarget "glycosylation" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2309 ; owl:annotatedTarget "Carbohydrate species chemically attached to proteins, or other organic molecules involved in an interaction that enables an interaction when compared with the non-glycosylated molecule, which does not interact." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2309 ; owl:annotatedTarget "attached carbohydrate causing" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2309 ; owl:annotatedTarget "glycosylation causing interaction" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2310 ; owl:annotatedTarget "Carbohydrate species chemically attached to proteins, or other organic molecules involved in an interaction that has no effect over an interaction when compared with the non-glycosylated molecule, which does not interact." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2310 ; owl:annotatedTarget "attached carbohydrate not affecting interaction" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0133 ; owl:annotatedTarget "[K:ac]" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2310 ; owl:annotatedTarget "glycosylation with no effect" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2311 ; owl:annotatedTarget "Carbohydrate species chemically attached to proteins, or other organic molecules involved in an interaction that decreases significantly interaction strength or rate (in the case of interactions inferred from enzymatic reaction) when compared with the non-glycosylated molecule." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2311 ; owl:annotatedTarget "attached carbohydrate decreasing" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2311 ; owl:annotatedTarget "glycosylation decreasing interaction" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2312 ; owl:annotatedTarget "Carbohydrate species chemically attached to proteins, or other organic molecules involved in an interaction that increases significantly interaction strength or rate (in the case of interactions inferred from enzymatic reaction) when compared with the non-glycosylated molecule." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2312 ; owl:annotatedTarget "attached carbohydrate increasing" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2312 ; owl:annotatedTarget "glycosylation increasing interaction" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2313 ; owl:annotatedTarget "Carbohydrate species chemically attached to proteins, or other organic molecules involved in an interaction that increases significantly interaction strength when compared with the non-glycosylated molecule." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2313 ; owl:annotatedTarget "attached carbohydrate increasing strength" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2313 ; owl:annotatedTarget "glycosylation increasing strength" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0133 ; owl:annotatedTarget "n2-acetyllysine" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2314 ; owl:annotatedTarget "Carbohydrate species chemically attached to proteins, or other organic molecules involved in an interaction that increases significantly interaction rate (in the case of interactions inferred from enzymatic reaction) when compared with the non-glycosylated molecule." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2314 ; owl:annotatedTarget "attached carbohydrate increasing rate" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2314 ; owl:annotatedTarget "glycosylation increasing rate" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2315 ; owl:annotatedTarget "Carbohydrate species chemically attached to proteins, or other organic molecules involved in an interaction that disrupts interaction rate (in the case of interactions inferred from enzymatic reaction) when compared with the non-glycosylated molecule." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2315 ; owl:annotatedTarget "attached carbohydrate disrupting rate" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2315 ; owl:annotatedTarget "glycosylation disrupting rate" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2316 ; owl:annotatedTarget "Carbohydrate species chemically attached to proteins, or other organic molecules involved in an interaction that disrupts interaction strength when compared with the non-glycosylated molecule." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2316 ; owl:annotatedTarget "attached carbohydrate disrupting strength" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2316 ; owl:annotatedTarget "glycosylation disrupting strength" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2317 ; owl:annotatedTarget "Carbohydrate species chemically attached to proteins, or other organic molecules involved in an interaction that disrupts interaction strength or rate (in the case of interactions inferred from enzymatic reaction) when compared with the non-glycosylated molecule." . [] oboInOwl:hasDbXref "PMID:11125103", "RESID:AA0055" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0134 ; owl:annotatedTarget """Residue modification. OBSOLETE remap to MOD:00064.""" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2317 ; owl:annotatedTarget "attached carbohydrate disrupting" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2317 ; owl:annotatedTarget "glycosylation disrupting interaction" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2318 ; owl:annotatedTarget "A technique that measures forces generated by interactions between molecules." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2318 ; owl:annotatedTarget "intermolecular force" . [] oboInOwl:hasDbXref "doi:10.1038/262774a0" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2319 ; owl:annotatedTarget "A technique that measures interaction force between two surfaces as they are brought together and retracted." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2320 ; owl:annotatedTarget "Alzheimer's Research UK Gene Ontology Project" . [] oboInOwl:hasDbXref "PMID:19900591" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2321 ; owl:annotatedTarget "High-throughput (a.k.a. \"next-generation\") sequencing applies to methods that allow for sequencing of genome-scale number of bases." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2321 ; owl:annotatedTarget "next-generation sequencing" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2321 ; owl:annotatedTarget "ngs sequencing" . [] oboInOwl:hasDbXref "PMID:18987734" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2322 ; owl:annotatedTarget "This method generates several billion bases of accurate nucleotide sequence per experiment at low cost. Single molecules of DNA are attached to a flat surface, amplified in situ and used as templates for synthetic sequencing with fluorescent reversible terminator deoxyribonucleotides. Images of the surface are analysed to generate high-quality sequence." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0134 ; owl:annotatedTarget "(S)-2-amino-6-(acetylamino)hexanoic acid" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2322 ; owl:annotatedTarget "illumina sequencing" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2322 ; owl:annotatedTarget "solexa sequencing" . [] oboInOwl:hasDbXref "PMID:25154561", "PMID:29855964" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2323 ; owl:annotatedTarget "KISS (KInase Substrate Sensor) is a protein complementation technology that allows in situ analysis of protein-protein interactions in intact mammalian cells. In this method, which is derived from MAPPIT (mammalian protein-protein interaction trap), the bait protein is coupled to the kinase domain of TYK2, while the prey protein is fused to a fragment of the gp130 cytokine receptor chain. Bait and prey interaction leads to phosphorylation of the gp130 anchor by TYK2, followed by recruitment and activation of STAT3, resulting in transcription of a STAT3-dependent reporter system. This approach enables the identification of interactions between proteins, including transmembrane and cytosolic proteins, and their modulation in response to physiological or pharmacological challenges." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2323 ; owl:annotatedTarget "KISS" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2323 ; owl:annotatedTarget "kinase substrate sensor" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2323 ; owl:annotatedTarget "kiss" . [] oboInOwl:hasDbXref "PMID:11125122" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2324 ; owl:annotatedTarget "dbSNP contains human single nucleotide variations, microsatellites, and small-scale insertions and deletions along with publication, population frequency, molecular consequence, and genomic and RefSeq mapping information for both common variations and clinical mutations." . [] a owl:Axiom ; rdfs:label "https://www.ncbi.nlm.nih.gov/snp/${ac}" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_2324 ; owl:annotatedTarget "search-url:" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2324 ; owl:annotatedTarget "dbSNP" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2324 ; owl:annotatedTarget "dbsnp" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0134 ; owl:annotatedTarget "KA6" . [] oboInOwl:hasDbXref "PMID:22894855" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2325 ; owl:annotatedTarget "NanoLuc luciferase (Nluc) is a small (19 kDa), highly stable, ATP independent, bioluminescent protein derived from the luciferase complex of the deep-sea shrimp O. gracilirostris." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2325 ; owl:annotatedTarget "NLuc" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2325 ; owl:annotatedTarget "NanoLuc" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2325 ; owl:annotatedTarget "nanoluc luciferase" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2325 ; owl:annotatedTarget "nluc" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2326 ; owl:annotatedTarget "N-terminal fragment of nanoluc luciferase" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2326 ; owl:annotatedTarget "nluc-n" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2327 ; owl:annotatedTarget "C-terminal fragment of nanoluc luciferase" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2327 ; owl:annotatedTarget "nluc-c" . [] oboInOwl:hasDbXref "PMID:12725859" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2328 ; owl:annotatedTarget "The SNAP-tag protein is an engineered version of the ubiquitous mammalian enzyme AGT, encoded in humans by the O-6-methylguanine-DNA methyltransferase (MGMT) gene. The tag is a 182 residues polypeptide with self-labeling activity that accepts O6-benzylguanine derivatives." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0134 ; owl:annotatedTarget "N(zeta)-acetyllysine" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2328 ; owl:annotatedTarget "SNAP tag" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2328 ; owl:annotatedTarget "snap tag" . [] oboInOwl:hasDbXref "PMID:27730562" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2329 ; owl:annotatedTarget "Hydrophobic interaction chromatography (HIC) separates proteins according to differences in their surface hydrophobicity by utilizing a reversible interaction between these proteins and the hydrophobic surface of a HIC matrix." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2329 ; owl:annotatedTarget "HIC" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2329 ; owl:annotatedTarget "hic" . [] oboInOwl:hasDbXref "PMID:19107426" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2330 ; owl:annotatedTarget "Covalent attachment of the small ubiquitin-like modifier (SUMO) protein as a fusion protein." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2330 ; owl:annotatedTarget "SUMO tag" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2330 ; owl:annotatedTarget "sumo tag" . [] oboInOwl:hasDbXref "PMID:9661810" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2331 ; owl:annotatedTarget "A bacteriophage library of genes encoding proteins or peptides fused to a phage coat protein that are expressed on the surface of the phage virion." . [] oboInOwl:hasDbXref "PMID:25438671" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2332 ; owl:annotatedTarget "Paramagnetic molecule formed by a gadolinium complex based on 4-mercaptomethyl-dipicolinic acid (4MMDPA) attached to a cysteine side chain." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0134 ; owl:annotatedTarget "N6-acetyl-L-lysine" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2332 ; owl:annotatedTarget "Gd3+-4MMDPA tag" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2332 ; owl:annotatedTarget "g1 spin label" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2332 ; owl:annotatedTarget "g1-spin label" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2334 ; owl:annotatedTarget "Fluorophore or luminiscence source which emits electromagnetic radiation of given wavelength." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2335 ; owl:annotatedTarget "Fluorophore able to absorb the electromagnetic radiation at given wavelength from a specific luminescence donor, then re-emit its own characteristic fluorescence. The luminescence donor may or may not be a fluorophore it self." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2335 ; owl:annotatedTarget "luminescence accept" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2336 ; owl:annotatedTarget "Pair of luminescence donor-fluorophore or fluorophores attached to the same molecule used in a bret or fret experiment to observe the details of conformational changes." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2336 ; owl:annotatedTarget "luminescence acceptor-donor pair" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2337 ; owl:annotatedTarget "Luminiscence source which emits electromagnetic radiation of given wavelength through a chemical process." . [] oboInOwl:hasDbXref "PMID:12160704" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2338 ; owl:annotatedTarget "Three-dimensional (3D) reconstruction of single, transparent objects from a series of projection images from a tilt series recorded with a transmission electron microscope." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0134 ; owl:annotatedTarget "[K:N6ac]" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2338 ; owl:annotatedTarget "3D-EM-tomo" . [] oboInOwl:hasDbXref "PMID:12160704" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2339 ; owl:annotatedTarget "Three-dimensional (3D) reconstruction of single, transparent objects from a collection of images of randomly oriented particles recorded with a transmission electron microscope." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2339 ; owl:annotatedTarget "3D-EM-single" . [] oboInOwl:hasDbXref "PMID:12160704" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2340 ; owl:annotatedTarget "Three-dimensional (3D) reconstruction of helical objects from a collection of fiber images recorded with a transmission electron microscope." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2340 ; owl:annotatedTarget "3D-EM-helical" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2341 ; owl:annotatedTarget "Fluorophore able to absorb the electromagnetic radiation at given wavelength from a specific luminescence donor and then act as a donor via re-emission of its own characteristic fluorescence. The luminescence donor may or may not be a fluorophore itself." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2342 ; owl:annotatedTarget "Reference to the corresponding object in another database. Correspondence is partial, so the objects are similar but explicitly not identical." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2342 ; owl:annotatedTarget "partial match" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2342 ; owl:annotatedTarget "similar object in an external resource" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2343 ; owl:annotatedTarget "Coordinates of a reference DNA sequence in the genome, providing information about the chromosome name, start and end of the sequence, optionally including the strand as well if it applies." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0016 ; owl:annotatedTarget "cd" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0134 ; owl:annotatedTarget "epsilon-acetyllysine" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2343 ; owl:annotatedTarget "genomic coord" . [] oboInOwl:hasDbXref "PMID:27980062" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2344 ; owl:annotatedTarget "Rhea is an expert curated resource of biochemical reactions designed for the annotation of enzymes and genome-scale metabolic networks and models. Rhea uses the ChEBI (Chemical Entities of Biological Interest) ontology of small molecules to precisely describe reactions participants and their chemical structures. All reactions are balanced for mass and charge and are linked to source literature, metabolic resources and other functional vocabularies such as the enzyme classification of the NC-IUBMB." . [] a owl:Axiom ; rdfs:label "https://www.rhea-db.org/reaction?id=${ac}" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_2344 ; owl:annotatedTarget "search-url:" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2344 ; owl:annotatedTarget "Rhea" . [] oboInOwl:hasDbXref "PMID:24480187" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2345 ; owl:annotatedTarget "The protein is fused to a 12-residue peptide segment (GVAMPGAEDDVV) derived from human podoplanin PLAG domain for which antibodies are available." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2345 ; owl:annotatedTarget "PA tag" . [] oboInOwl:hasDbXref "PMID:20566373" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2346 ; owl:annotatedTarget "Protein is fused to a 21 amino acid residues-long peptide (YPGQYPGQYPGQYPGQYPGQV) derived from human PAR-4 N-terminal peptide. The final sequence of the peptide resulted from optimization involving mutagenesis and repetition of the original reference sequence in order to maximize affinity with the P20.1 antibody." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2346 ; owl:annotatedTarget "TARGET tag" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2346 ; owl:annotatedTarget "tandemly-arranged recognition motif combined with gentle elution technology tag" . [] a owl:Axiom ; rdfs:label "\\d+.\\d+/[a-zA-Z0-9\\.\\:]+" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_2347 ; owl:annotatedTarget "id-validation-regexp:" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0134 ; owl:annotatedTarget "n6-acetyllysine" . [] a owl:Axiom ; rdfs:label "https://www.biorxiv.org/content/${ac}" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_2347 ; owl:annotatedTarget "search-url:" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2347 ; owl:annotatedTarget "bioRxiv" . [] oboInOwl:hasDbXref "PMID:18587404" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2348 ; owl:annotatedTarget "In sequential BRET-FRET (BRET combined with FRET) bioluminiscence generated by a luciferase triggers acceptor excitation by BRET and subsequent energy transfer to a FRET acceptor. This technique can identify multimolecular complexes through detection of the resulting fluoresecence." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2348 ; owl:annotatedTarget "SRET" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2348 ; owl:annotatedTarget "Sequential BRET-FRET" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2348 ; owl:annotatedTarget "sret" . [] oboInOwl:hasDbXref "PMID:29165669" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2349 ; owl:annotatedTarget """ClinVar is a freely accessible, public archive of reports of the relationships among human variations and phenotypes, with supporting evidence. https://www.ncbi.nlm.nih.gov/clinvar""" . [] a owl:Axiom ; rdfs:label "[0-9]+" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_2349 ; owl:annotatedTarget "id-validation-regexp:" . [] a owl:Axiom ; rdfs:label "https://www.ncbi.nlm.nih.gov/clinvar/variation/${ac}" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_2349 ; owl:annotatedTarget "search-url:" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2349 ; owl:annotatedTarget "ClinVAR" . [] oboInOwl:hasDbXref "PMID:11125103", "RESID:AA0049" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0135 ; owl:annotatedTarget """Residue modification. OBSOLETE remap to MOD:00058.""" . [] oboInOwl:hasDbXref "PMID:27067018" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2350 ; owl:annotatedTarget """EMPIAR, the Electron Microscopy Public Image Archive, is a public resource for raw, 2D electron microscopy images. The purpose of EMPIAR is to provide easy access to state-of-the-art raw data to facilitate methods development and validation, which will lead to better 3D structures. It complements the Electron Microscopy Data Bank (EMDB), where 3D volumes are stored, and uses the fault-tolerant Aspera platform for data transfers. https://www.ebi.ac.uk/empiar""" . [] a owl:Axiom ; rdfs:label "EMPIAR-[0-9]{5}" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_2350 ; owl:annotatedTarget "id-validation-regex:" . [] a owl:Axiom ; rdfs:label "https://www.ebi.ac.uk/empiar/${ac}" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_2350 ; owl:annotatedTarget "search-url:" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2350 ; owl:annotatedTarget "EMPIAR" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2350 ; owl:annotatedTarget "Electron Microscopy Public Image Archive" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2350 ; owl:annotatedTarget "empiar" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2351 ; owl:annotatedTarget "A gene whose genetic perturbation enhances the phenotype resulting from a different genetic perturbation." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2351 ; owl:annotatedTarget "enhancer" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2352 ; owl:annotatedTarget "A gene whose genetic perturbation phenotype is enhanced by a different genetic perturbation." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2352 ; owl:annotatedTarget "enhanced" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0135 ; owl:annotatedTarget "(S)-2-acetylamino-4-(methylsulfanyl)butanoic acid" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2353 ; owl:annotatedTarget "A gene whose genetic perturbation masks the phenotype resulting from a different genetic perturbation." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2353 ; owl:annotatedTarget "epistatic" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2354 ; owl:annotatedTarget "A gene whose genetic perturbation phenotype is masked by a different genetic perturbation." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2354 ; owl:annotatedTarget "hypostatic" . [] oboInOwl:hasDbXref "PMID:14760721" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2355 ; owl:annotatedTarget "Measurement of the substraction of one or more ADP-ribose moieties to molecules." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2355 ; owl:annotatedTarget "adp deribosylase" . [] oboInOwl:hasDbXref "GO:0051725", "PMID:14755292", "RESID:AA0168", "RESID:AA0169", "RESID:AA0231", "RESID:AA0237", "RESID:AA0295" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2356 ; owl:annotatedTarget "Involves the substraction of one or more ADP-ribose moieties to proteins. Reaction that can affect Arg, Cys, Glu, Arg and Asn residues." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2356 ; owl:annotatedTarget "adp de-ribosylation" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2356 ; owl:annotatedTarget "adp deribosylation" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2357 ; owl:annotatedTarget "This parameter represents the rate of the reaction at negligible substrate concentration, indicating how the velocity varies according to how often enzyme and substrate combine." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0135 ; owl:annotatedTarget "2-acetylamino-4-(methylthio)butanoic acid" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2357 ; owl:annotatedTarget "catalytic efficiency" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2357 ; owl:annotatedTarget "kcat/km" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2357 ; owl:annotatedTarget "specificity constant" . [] oboInOwl:hasDbXref "PMID:30423142" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2358 ; owl:annotatedTarget """A searchable database of published miRNA sequences and annotation. Each entry in the miRBase Sequence database represents a predicted hairpin portion of a miRNA transcript (termed mir in the database), with information on the location and sequence of the mature miRNA sequence (termed miR). Both hairpin and mature sequences are available for searching and browsing, and entries can also be retrieved by name, keyword, references and annotation. All sequence and annotation data are also available for download. Homepage: http://www.mirbase.org/""" . [] a owl:Axiom ; rdfs:label "http://www.mirbase.org/cgi-bin/mirna_entry.pl?acc=${ac}" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_2358 ; owl:annotatedTarget "search-url:" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2358 ; owl:annotatedTarget "miRBASE" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2359 ; owl:annotatedTarget "RNA that consists of two base pairing strands. The 2 nucleotide chains are held together by hydrogen bonds between base pairs of nucleotides." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2359 ; owl:annotatedTarget "double stranded ribonucleic acid" . [] oboInOwl:hasDbXref "PMID:10459153" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2360 ; owl:annotatedTarget "Protein is fused to beta-galactosidase, and the measure of this enzyme activity can be taken as indicative of presence of protein." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2360 ; owl:annotatedTarget "beta gal tag" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0135 ; owl:annotatedTarget "MAC" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2360 ; owl:annotatedTarget "beta-galactosidase tag" . [] oboInOwl:hasDbXref "PMID:32415080" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2361 ; owl:annotatedTarget "Bait protein is fused to a standard protein fusion tag and an intein fragment, prey a with a different protein fusion tag and the complementary intein fragment. The bait and prey are co-expressed in a cell line where the association of bait and prey brings the intein fragments into close proximity, allowing them to reconstitute a fully functional intein, which then catalyzes its own excision and the concurrent ligation of the bait and the prey peptides (as well as the standard protein fusion tags). The resulting spliced protein can be resolved by regular western blot analysis due to its altered mobility, while the presence of the standard protein fusion tags allows visualization or purification of protein using regular biochemical techniques." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2361 ; owl:annotatedTarget "SIMPL" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2361 ; owl:annotatedTarget "simpl" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2362 ; owl:annotatedTarget "IC tag" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2362 ; owl:annotatedTarget "intein c-terminal fragment tag" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2363 ; owl:annotatedTarget "IN tag" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2363 ; owl:annotatedTarget "intein n-terminal fragment tag" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2364 ; owl:annotatedTarget "close-contact colocalization" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2364 ; owl:annotatedTarget "neighbourhood interaction" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0135 ; owl:annotatedTarget "N-acetyl-L-methionine" . [] oboInOwl:hasDbXref "PMID:31784573" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2365 ; owl:annotatedTarget "FluoPPI system (Fluorescent Protein-Protein Interaction-visualization):-FLUOPPI utilises the formation of fluorescence foci whereby the interacting proteins of interest are genetically fused with either a tetramerizing fluorescent protein (FP-tag) or an assembly helper tag (Ash-tag). The incorporation of these tags onto a pair of interacting proteins enables the formation of intensely bright foci when co-expressed in mammalian cells. In these foci the FP-tag induces the fused protein to form a tetramer that can now interact with up to 4 copies of the Ash-tagged partner protein. The cognate interacting protein also forms an oligomer through the Ash tag, which in turn can interact with multiple copies of the FP-fused partner protein. The potential of both constructs to interact with multiple copies of each other enable large foci incorporating the fluorescent protein to form, which can be clearly observed when imaging the cell." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2365 ; owl:annotatedTarget "FluoPPI" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2365 ; owl:annotatedTarget "fluoppi" . [] oboInOwl:hasDbXref "PMID:19712041" ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasBroadSynonym ; owl:annotatedSource obo:MI_2394 ; owl:annotatedTarget "aggravating interaction" . [] oboInOwl:hasDbXref "PMID:19712041" ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasBroadSynonym ; owl:annotatedSource obo:MI_2394 ; owl:annotatedTarget "synergistic interaction" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2394 ; owl:annotatedTarget "negative gen int" . [] oboInOwl:hasDbXref "PMID:19712041" ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasBroadSynonym ; owl:annotatedSource obo:MI_2395 ; owl:annotatedTarget "alleviating interaction" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2395 ; owl:annotatedTarget "positive gent int" . [] oboInOwl:hasDbXref "PMID:22412018" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2403 ; owl:annotatedTarget "E. coli BirA* biotin ligase tag used in BioID experiments. This generally refers to a promiscuous mutant version of the biotin ligase with an R118H mutation." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2403 ; owl:annotatedTarget "BirA* biotin ligase tag" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0135 ; owl:annotatedTarget "[M:ac]" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2403 ; owl:annotatedTarget "BirA* tag" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2403 ; owl:annotatedTarget "bira biotin ligase tag" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2403 ; owl:annotatedTarget "bira tag" . [] oboInOwl:hasDbXref "PMID:31273118" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2404 ; owl:annotatedTarget "Enzymatic oxido-reductions where only O2 is an acceptor of hydrogen or electrons" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2404 ; owl:annotatedTarget "oxidase" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2404 ; owl:annotatedTarget "oxidase" . [] oboInOwl:hasDbXref "PMID:23446348" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2405 ; owl:annotatedTarget "Circular RNAs are stable circular transcripts generated when a pre-mRNA undergoes “backsplicing” to join a splice donor to an upstream splice acceptor. They can originate from exons, introns or lncRNAs." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2405 ; owl:annotatedTarget "circRNA" . [] oboInOwl:hasDbXref "PMID:34415304" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2406 ; owl:annotatedTarget "Ribozymes (ribonucleic acid enzymes) are folded catalytic RNA molecules that perform important biological functions." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2406 ; owl:annotatedTarget "ribozyme" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0135 ; owl:annotatedTarget "acetylmethionine" . [] oboInOwl:hasDbXref "PMID:22293552" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2407 ; owl:annotatedTarget """Uberon is an integrated cross-species anatomy ontology representing a variety of entities classified according to traditional anatomical criteria such as structure, function and developmental lineage. https://www.ebi.ac.uk/ols/ontologies/uberon""" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2407 ; owl:annotatedTarget "uberon" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2408 ; owl:annotatedTarget "COVID-19 Vocabulary" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2408 ; owl:annotatedTarget "CoVoc" . [] oboInOwl:hasDbXref "PMID:23220694" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2409 ; owl:annotatedTarget """The Plant Ontology is a structured vocabulary and database resource that links plant anatomy, morphology and growth and development to plant genomics data. https://www.ebi.ac.uk/ols/ontologies/po""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2409 ; owl:annotatedTarget "PO" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2409 ; owl:annotatedTarget "plant ontology" . [] oboInOwl:hasDbXref "PMID:31701156" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2410 ; owl:annotatedTarget """A semi-automatically constructed ontology that merges in multiple disease resources to yield a coherent merged ontology. https://www.ebi.ac.uk/ols/ontologies/mondo""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2410 ; owl:annotatedTarget "mondo" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2410 ; owl:annotatedTarget "mondo" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0135 ; owl:annotatedTarget "acetylmethionine" . [] oboInOwl:hasDbXref "PMID:32778839" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2411 ; owl:annotatedTarget "The protein of interest is expressed as a fusion to a MAC-tag, which contains a twin-strep affinity tag and BirA* in one construct, requires generation of only one isogenic cell line and allows one-step protein purification by Strep-Tactin matrix for both AP–MS and BioID pipelines." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2411 ; owl:annotatedTarget "mac-tag" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2411 ; owl:annotatedTarget "mac-tag" . [] oboInOwl:hasDbXref "PMID:24658140" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2412 ; owl:annotatedTarget "Protein complementation methods specifically developed to assay for interactions of membrane proteins with both cytosolic or membrane-bound partners." . [] oboInOwl:hasExactSynonym "PSI-MI-short" ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2412 ; owl:annotatedTarget "MTH" . [] oboInOwl:hasDbXref "PMID:24658140" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2413 ; owl:annotatedTarget "A membrane bait protein is tagged with the C-terminal half of ubiquitin (Cub) and a chimeric transcription factor, and a cytosolic or membrane-bound prey is tagged with the N-terminal half of ubiquitin (Nub). Upon interaction of bait and prey, the split halves form pseudoubiquitin, which is recognized by cytosolic deubiquitinating enzymes, resulting in cleavage of the transcription factor and expression of a reporter gene." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2413 ; owl:annotatedTarget "MAMTH" . [] oboInOwl:hasDbXref "PMID:29805321" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2414 ; owl:annotatedTarget "The Cellosaurus is a knowledge resource on cell lines. It aims to describe all cell lines used in biomedical research." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2414 ; owl:annotatedTarget "cellosaurus" . [] oboInOwl:hasDbXref "PMID:25852852" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2415 ; owl:annotatedTarget "The Cell Line Ontology (CLO) is a community-based ontology of cell lines. The CLO is developed to unify publicly available cell line entry data from multiple sources to a standardized logically defined format based on consensus design patterns." . [] oboInOwl:hasDbXref "PMID:7708014" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0017 ; owl:annotatedTarget "Proteins contain endogenous fluorophores such as tryptophan residue and heme or flavins groups. Protein folding and protein-protein interaction can be studied by monitoring changes in the tryptophan environment detected by changes in its intrinsic fluorescence. Changes in the fluorescence emission spectrum on complex formation can occur either due to a shift in the wavelength of maximum fluorescence emission or by a shift in fluorescence intensity caused by the mixing of two proteins. The interaction of two proteins causes a shift in the fluorescence emission spectrum relative to the sum of the individual fluorescence spectra, resulting in a difference spectrum [F (complex)-2 F (sum)], which is a measurable effect of the interaction. Loss of fluorescence signal from a substrate can be used to measure protein cleavage." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0135 ; owl:annotatedTarget "methionamine" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2415 ; owl:annotatedTarget "CLO" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2415 ; owl:annotatedTarget "Cell Line Ontology" . [] oboInOwl:hasDbXref "PMID:34791415" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2416 ; owl:annotatedTarget """Ensembl Bacteria is a browser for bacterial and archaeal genomes. https://bacteria.ensembl.org/""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2416 ; owl:annotatedTarget "Ensembl Bacteria" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2416 ; owl:annotatedTarget "ensembl bacteria" . [] oboInOwl:hasDbXref "PMID:34791415" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2417 ; owl:annotatedTarget "Ensembl Fungi is a browser for fungal genomes. https://fungi.ensembl.org/" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2417 ; owl:annotatedTarget "Ensembl Fungi" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2417 ; owl:annotatedTarget "ensembl fungi" . [] oboInOwl:hasDbXref "PMID:34791415" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2418 ; owl:annotatedTarget "Ensembl Metazoa is a is a browser for genomes of metazoan species of scientific interest. https://metazoa.ensembl.org/" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2418 ; owl:annotatedTarget "Ensembl Metazoa" . [] oboInOwl:hasDbXref "PMID:11125103" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0136 ; owl:annotatedTarget """Residue modification. OBSOLETE remap to MOD:00784.""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2418 ; owl:annotatedTarget "ensembl metazoa" . [] oboInOwl:hasDbXref "PMID:27987162" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2419 ; owl:annotatedTarget """Ensembl Plants is a browser for plant genomes. https://plants.ensembl.org/""" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2419 ; owl:annotatedTarget "Ensembl Plants" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2419 ; owl:annotatedTarget "ensembl plants" . [] oboInOwl:hasDbXref "PMID:34791415" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2420 ; owl:annotatedTarget "Ensembl Protists is a browser for protist genomes. https://protists.ensembl.org/" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2420 ; owl:annotatedTarget "Ensembl Protists" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2420 ; owl:annotatedTarget "ensembl protists" . [] oboInOwl:hasDbXref "PMID:11752255" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2421 ; owl:annotatedTarget """SubtiList is the reference database dedicated to the genome of Bacillus subtilis, the paradigm of Gram-positive endospore-forming bacteria. http://genolist.pasteur.fr/SubtiList/""" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2421 ; owl:annotatedTarget "Subtilist" . [] oboInOwl:hasDbXref "PMID:32167227" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2422 ; owl:annotatedTarget "Mass photometry measures mass at the single molecule level in solution and enables the quantification of protein–protein interactions in solution with sufficient sensitivity to accurately determine stoichiometry and rate of reactions." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0136 ; owl:annotatedTarget "FAC" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2422 ; owl:annotatedTarget "mass photometry" . [] oboInOwl:hasDbXref "PMID:33973408" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2424 ; owl:annotatedTarget """HuMap is a a machine learning framework to identify protein complexes from mass spectrometry and other large-scale interaction experiments. HuMap 2.0 is presented as a searchable web resource (http://humap2.proteincomplexes.org/) using data from 15,000 mass spectrometry experiments to identify nearly 7,000 physical assemblies. HuMap3.0 is in preparation. https://humap2.proteincomplexes.org/""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2424 ; owl:annotatedTarget "HuMap" . [] oboInOwl:hasDbXref "PMID:31690884" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_2425 ; owl:annotatedTarget """A web-resource (https://www.proteomehd.net/index) that provides a co-regulation map of the human proteome built from ProteomeHD data (5,288 individual mass spectrometry experiments) and datasets from the Proteomics Identifications dataset using the machine learning algorithm treeClust to identify functional associations between co-regulated human proteins. https://www.proteomehd.net/proteomehd""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_2426 ; owl:annotatedTarget "orthology-group" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0136 ; owl:annotatedTarget "N-acetyl-L-phenylalanine" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0136 ; owl:annotatedTarget "[F:ac]" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0136 ; owl:annotatedTarget "acetylphenylalanine" . [] oboInOwl:hasDbXref "PMID:11125103", "RESID:AA0050" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0137 ; owl:annotatedTarget """Residue modification. OBSOLETE remap to MOD:00059.""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0137 ; owl:annotatedTarget "(2S)-1-acetyl-2-pyrrolidinecarboxylic acid" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0137 ; owl:annotatedTarget "N-acetyl-L-proline" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0137 ; owl:annotatedTarget "PAC" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0017 ; owl:annotatedTarget "fluorescence spectr" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0137 ; owl:annotatedTarget "[P:ac]" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0137 ; owl:annotatedTarget "acetylproline" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0137 ; owl:annotatedTarget "acetylproline" . [] oboInOwl:hasDbXref "PMID:11125103", "RESID:AA0051" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0138 ; owl:annotatedTarget """Residue modification. OBSOLETE remap to MOD:00060.""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0138 ; owl:annotatedTarget "(S)-2-acetylamino-3-hydroxypropanoic acid" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0138 ; owl:annotatedTarget "N-acetyl-L-serine" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0138 ; owl:annotatedTarget "N-acetylserine" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0138 ; owl:annotatedTarget "SAC" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0138 ; owl:annotatedTarget "[S:ac]" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0138 ; owl:annotatedTarget "acetylserine" . [] oboInOwl:hasDbXref "PMID:10967325", "PMID:12634794", "PMID:1946372" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0018 ; owl:annotatedTarget "The classical two-hybrid system is a method that uses transcriptional activity as a measure of protein-protein interaction. It relies on the modular nature of many site-specific transcriptional activators (GAL 4) , which consist of a DNA-binding domain and a transcriptional activation domain. The DNA-binding domain serves to target the activator to the specific genes that will be expressed, and the activation domain contacts other proteins of the transcriptional machinery to enable transcription to occur. The two-hybrid system is based on the observation that the two domains of the activator need to be non-covalently brought together by the interaction of any two proteins. The application of this system requires the expression of two hybrid. Generally this assay is performed in yeast cell, but it can also be carried out in other organism. The bait protein is fused to the DNA binding molecule, the prey to the transcriptional activator." . [] oboInOwl:hasDbXref "PMID:11125103", "RESID:AA0052" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0139 ; owl:annotatedTarget """Residue modification. OBSOLETE remap to MOD:00061.""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0139 ; owl:annotatedTarget "(2S,3R)-2-acetylamino-3-hydroxybutanoic acid" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0139 ; owl:annotatedTarget "N-acetyl-L-threonine" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0139 ; owl:annotatedTarget "N-acetylthreonine" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0139 ; owl:annotatedTarget "TAC" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0139 ; owl:annotatedTarget "[T:ac]" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0139 ; owl:annotatedTarget "acetylthreonine" . [] oboInOwl:hasDbXref "PMID:11125103" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0140 ; owl:annotatedTarget """Residue modification. OBSOLETE remap to MOD:00785.""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0140 ; owl:annotatedTarget "N-acetyl-L-tryptophan" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0140 ; owl:annotatedTarget "WAC" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0018 ; owl:annotatedTarget "2 hybrid" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0140 ; owl:annotatedTarget "[W:ac]" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0140 ; owl:annotatedTarget "acetyltryptophan" . [] oboInOwl:hasDbXref "PMID:11125103", "RESID:AA0053" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0141 ; owl:annotatedTarget """Residue modification. OBSOLETE remap to MOD:00062.""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0141 ; owl:annotatedTarget "(S)-2-acetylamino-3-(4-hydoxyphenyl)propanoic acid" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0141 ; owl:annotatedTarget "N-acetyl-L-tyrosine" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0141 ; owl:annotatedTarget "N-acetyltyrosine" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0141 ; owl:annotatedTarget "YAC" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0141 ; owl:annotatedTarget "[Y:ac]" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0141 ; owl:annotatedTarget "acetyltyrosine" . [] oboInOwl:hasDbXref "PMID:11125103", "RESID:AA0054" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0142 ; owl:annotatedTarget """Residue modification. OBSOLETE remap to MOD:00063.""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0018 ; owl:annotatedTarget "2-hybrid" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0142 ; owl:annotatedTarget "(S)-2-acetylamino-3-methylbutanoic acid" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0142 ; owl:annotatedTarget "N-acetyl-L-valine" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0142 ; owl:annotatedTarget "N-acetylvaline" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0142 ; owl:annotatedTarget "VAC" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0142 ; owl:annotatedTarget "[V:ac]" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0142 ; owl:annotatedTarget "acetylvaline" . [] oboInOwl:hasDbXref "PMID:11125103" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0143 ; owl:annotatedTarget """Residue modification. OBSOLETE remap to MOD:00674.""" . [] oboInOwl:hasDbXref "PMID:11125103", "RESID:AA0082" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0145 ; owl:annotatedTarget """Residue modification. OBSOLETE remap to MOD:00091.""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0145 ; owl:annotatedTarget "(S)-2-amino-5-guanidinopentanamide" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0145 ; owl:annotatedTarget "L-arginine amide" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0001 ; owl:annotatedTarget "interaction detect" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0018 ; owl:annotatedTarget "2H" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0145 ; owl:annotatedTarget "RAM" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0145 ; owl:annotatedTarget "[R:am]" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0145 ; owl:annotatedTarget "argininamide" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0145 ; owl:annotatedTarget "arginineamide" . [] oboInOwl:hasDbXref "PMID:11125103" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0146 ; owl:annotatedTarget """Residue modification. OBSOLETE remap to MOD:00493.""" . [] oboInOwl:hasDbXref "PMID:11125103", "RESID:AA0021" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0147 ; owl:annotatedTarget """Residue modification. OBSOLETE remap to MOD:00030.""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0147 ; owl:annotatedTarget "(S)-2-formylamino-4-(methylsulfanyl)butanoic acid" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0147 ; owl:annotatedTarget "2-formylamino-4-(methylthio)butanoic acid" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0147 ; owl:annotatedTarget "MFM" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0147 ; owl:annotatedTarget "N-formyl-L-methionine" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0018 ; owl:annotatedTarget "2h" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0147 ; owl:annotatedTarget "[M:form]" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0147 ; owl:annotatedTarget "formylmethionine" . [] oboInOwl:hasDbXref "PMID:11125103" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0148 ; owl:annotatedTarget """Residue modification. OBSOLETE remap to MOD:00428.""" . [] oboInOwl:hasDbXref "PMID:11125103" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0150 ; owl:annotatedTarget """Residue modification. OBSOLETE remap to MOD:01155.""" . [] oboInOwl:hasDbXref "PMID:11125103", "RESID:AA0102" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0151 ; owl:annotatedTarget """Residue modification. OBSOLETE remap to MOD:00111.""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0151 ; owl:annotatedTarget "(R,E,E)-2-amino-3-(3,7,11-trimethyl-2,6,10-dodecatrienylsulfanyl)propanoic acid" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0151 ; owl:annotatedTarget "2-amino-3-(3,7,11-trimethyl-2,6,10-dodecatrienylthio)propanoic acid" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0151 ; owl:annotatedTarget "CFN" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0151 ; owl:annotatedTarget "S-farnesyl-L-cysteine" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0151 ; owl:annotatedTarget "[C:farn]" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0018 ; owl:annotatedTarget "Gal4 transcription regeneration" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0151 ; owl:annotatedTarget "farnesylcysteine" . [] oboInOwl:hasDbXref "PMID:11125103", "RESID:AA0104" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0152 ; owl:annotatedTarget """Residue modification. OBSOLETE remap to MOD:00113.""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0152 ; owl:annotatedTarget "(R,E,E,E)-2-amino-3-(3,7,11,15-tetramethyl-2,6,10,14-hexadecatetraenylsulfanyl)propanoic acid" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0152 ; owl:annotatedTarget "2-amino-3-(3,7,11,15-tetramethyl-2,6,10,14-hexadecatetraenylthio)propanoic acid" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0152 ; owl:annotatedTarget "CGR" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0152 ; owl:annotatedTarget "S-geranylgeranyl-L-cysteine" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0152 ; owl:annotatedTarget "[C:ger]" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0152 ; owl:annotatedTarget "geranylgeranylcys" . [] oboInOwl:hasDbXref "PMID:11125103", "RESID:AA0060" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0153 ; owl:annotatedTarget """Residue modification. OBSOLETE remap to MOD:00069.""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0153 ; owl:annotatedTarget "(R)-2-hexadecanoylamino-3-sulfanylpropanoic acid" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0018 ; owl:annotatedTarget "classical two hybrid" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0153 ; owl:annotatedTarget "2-hexadecanoylamino-3-mercaptopropanoic acid" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0153 ; owl:annotatedTarget "CPN" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0153 ; owl:annotatedTarget "N-(1-oxahexadecyl)-L-cysteine" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0153 ; owl:annotatedTarget "N-palmitoyl-L-cysteine" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0153 ; owl:annotatedTarget "[C:palm_n]" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0153 ; owl:annotatedTarget "n-palmitoylcysteine" . [] oboInOwl:hasDbXref "PMID:11125103", "RESID:AA0106" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0154 ; owl:annotatedTarget """Residue modification. OBSOLETE remap to MOD:00115.""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0154 ; owl:annotatedTarget "(R)-2-amino-3-(hexadecanoylsulfanyl)propanoic acid" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0154 ; owl:annotatedTarget "2-amino-3-(hexadecanoylthio)propanoic acid" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0154 ; owl:annotatedTarget "CPS" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0018 ; owl:annotatedTarget "two-hybrid" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0154 ; owl:annotatedTarget "S-palmitoyl-L-cysteine" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0154 ; owl:annotatedTarget "[C:palm_s]" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0154 ; owl:annotatedTarget "cysteine hexadecanoate thioester" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0154 ; owl:annotatedTarget "cysteine palmitate thioester" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0154 ; owl:annotatedTarget "s-palmitoylcysteine" . [] oboInOwl:hasDbXref "PMID:11125103", "RESID:AA0059" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0155 ; owl:annotatedTarget """Residue modification. OBSOLETE remap to MOD:00068.""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0155 ; owl:annotatedTarget "GMY" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0155 ; owl:annotatedTarget "N-myristoyl-glycine" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0155 ; owl:annotatedTarget "[G:myr]" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0155 ; owl:annotatedTarget "myristoylglycine" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0018 ; owl:annotatedTarget "yeast two hybrid" . [] oboInOwl:hasDbXref "PMID:11125103", "RESID:AA0078" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0156 ; owl:annotatedTarget """Residue modification. OBSOLETE remap to MOD:00087.""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0156 ; owl:annotatedTarget "(S)-2-amino-6-(tetradecanoylamino)hexanoic acid" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0156 ; owl:annotatedTarget "KMY" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0156 ; owl:annotatedTarget "N(zeta)-myristoyllysine" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0156 ; owl:annotatedTarget "N6-(1-oxotetradecyl)-L-lysine" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0156 ; owl:annotatedTarget "N6-myristoyl-L-lysine" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0156 ; owl:annotatedTarget "[K:myr]" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0156 ; owl:annotatedTarget "epsilon-myristoyllysine" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0156 ; owl:annotatedTarget "myristoyllysine" . [] oboInOwl:hasDbXref "PMID:11125103" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0157 ; owl:annotatedTarget """Residue modification. OBSOLETE remap to MOD:00427.""" . [] oboInOwl:hasDbXref "PMID:7708014" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0019 ; owl:annotatedTarget "In this approach an antibody, specific for the molecule of interest (bait) or any tag expressed within a fusion protein, is used to separate the bait from a molecular mixture or a cell lysate and to capture its ligand simultaneously. The partners that bind to the bait molecule retained by the resin can then be eluted and identified. The antibody may be free or bound to a matrix during this process." . [] oboInOwl:hasDbXref "PMID:11125103", "RESID:AA0061" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0158 ; owl:annotatedTarget """Residue modification. OBSOLETE remap to MOD:00070.""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0158 ; owl:annotatedTarget "(S)-2-methylaminopropanoic acid" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0158 ; owl:annotatedTarget "AMT" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0158 ; owl:annotatedTarget "N-methyl-L-alanine" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0158 ; owl:annotatedTarget "N-methylalanine" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0158 ; owl:annotatedTarget "[A:meth_n]" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0158 ; owl:annotatedTarget "methylalanine" . [] oboInOwl:hasDbXref "PMID:11125103", "RESID:AA0062" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0159 ; owl:annotatedTarget """Residue modification. OBSOLETE remap to MOD:00071.""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0159 ; owl:annotatedTarget "(S)-1-carboxy-N,N,N-trimethylethanaminium" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0159 ; owl:annotatedTarget "(S)-2-(trimethylammonio)propanoic acid" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0019 ; owl:annotatedTarget "Co-IP" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0159 ; owl:annotatedTarget "AM3" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0159 ; owl:annotatedTarget "N,N,N-trimethyl-L-alanine" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0159 ; owl:annotatedTarget "[A:meth_n3]" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0159 ; owl:annotatedTarget "trimethylalanine" . [] oboInOwl:hasDbXref "PMID:11125103", "RESID:AA0068" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0160 ; owl:annotatedTarget """Residue modification. OBSOLETE remap to MOD:00077.""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0160 ; owl:annotatedTarget "(S)-2-amino-5-[((dimethylamino)iminomethyl)amino]pentanoic acid" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0160 ; owl:annotatedTarget "NG,NG-dimethylarginine" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0160 ; owl:annotatedTarget "RM2" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0160 ; owl:annotatedTarget "[R:meth_n7]" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0160 ; owl:annotatedTarget "asymmetric dimethylarginine" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0019 ; owl:annotatedTarget "CoIp" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0160 ; owl:annotatedTarget "dimethylarginine" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0160 ; owl:annotatedTarget "omega-N,omega-N-dimethyl-L-arginine" . [] oboInOwl:hasDbXref "PMID:11125103", "RESID:AA0232" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0161 ; owl:annotatedTarget """Residue modification. OBSOLETE remap to MOD:00237.""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0161 ; owl:annotatedTarget "(2R,3Xi)-2-amino-3-methylsulfanylbutanedioic acid" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0161 ; owl:annotatedTarget "3-carboxy-S-methyl-cysteine" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0161 ; owl:annotatedTarget "3-methylthio-aspartic acid" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0161 ; owl:annotatedTarget "DM2" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0161 ; owl:annotatedTarget "L-beta-methylthioaspartic acid" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0161 ; owl:annotatedTarget "[D:meth_b]" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0161 ; owl:annotatedTarget "beta-methylthio-aspartic acid" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0019 ; owl:annotatedTarget "co-immunoprecipitation" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0161 ; owl:annotatedTarget "methylthioaspartate" . [] oboInOwl:hasDbXref "PMID:11125103", "RESID:AA0071" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0162 ; owl:annotatedTarget """Residue modification. OBSOLETE remap to MOD:00080.""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0162 ; owl:annotatedTarget "(S)-2-amino-N5-methylpentanediamic acid" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0162 ; owl:annotatedTarget "N(delta)-methylglutamine" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0162 ; owl:annotatedTarget "N-methylglutamine" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0162 ; owl:annotatedTarget "N5-methyl-L-glutamine" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0162 ; owl:annotatedTarget "QM5" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0162 ; owl:annotatedTarget "[Q:meth_n5]" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0162 ; owl:annotatedTarget "gamma-methylglutamine" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0162 ; owl:annotatedTarget "methylglutamine" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0002 ; owl:annotatedTarget "Method to determine the molecules involved in the interaction." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0019 ; owl:annotatedTarget "coip" . [] oboInOwl:hasDbXref "PMID:11125103", "RESID:AA0072" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0163 ; owl:annotatedTarget """Residue modification. OBSOLETE remap to MOD:00081.""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0163 ; owl:annotatedTarget "(S)-2-aminopentanedioic acid 5-methyl ester" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0163 ; owl:annotatedTarget "5-methyl-L-glutamate" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0163 ; owl:annotatedTarget "EM5" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0163 ; owl:annotatedTarget "L-glutamic acid 5-methyl ester" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0163 ; owl:annotatedTarget "[E:meth_o5]" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0163 ; owl:annotatedTarget "glutamatemethylester" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0163 ; owl:annotatedTarget "glutamic acid gamma-methyl ester" . [] oboInOwl:hasDbXref "PMID:11125103" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0165 ; owl:annotatedTarget """Residue modification. OBSOLETE remap to MOD:00085.""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0165 ; owl:annotatedTarget "(S)-2-amino-6-methylaminohexanoic acid" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0019 ; owl:annotatedTarget "immunoprecipitation" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0165 ; owl:annotatedTarget "MLZ" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0165 ; owl:annotatedTarget "N(zeta)-methyllysine" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0165 ; owl:annotatedTarget "N6-methyl-L-lysine" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0165 ; owl:annotatedTarget "[K:meth_1]" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0165 ; owl:annotatedTarget "epsilon-methyllysine" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0165 ; owl:annotatedTarget "methyllysine" . [] oboInOwl:hasDbXref "PMID:11125103", "RESID:AA0075" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0166 ; owl:annotatedTarget """Residue modification. OBSOLETE remap to MOD:00084.""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0166 ; owl:annotatedTarget "(S)-2-amino-6-dimethylaminohexanoic acid" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0166 ; owl:annotatedTarget "MLY" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0166 ; owl:annotatedTarget "N(zeta)-dimethyllysine" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0020 ; owl:annotatedTarget "Microscopy technique in which a beam of electrons is transmitted through a sample to form an image. Samples can be purified molecules, for which no staining is required in order to detect interaction, or tissue/cells. In the latter case, during the treatment for microscope analysis a tissue section is incubated with high-specificity antibodies coupled to heavy metals (e.g. gold). Any tissue section can then be analysed by electron microscopy to localise the target proteins within the cell. This method supports very high resolution colocalisation of different molecules in a cell." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0166 ; owl:annotatedTarget "N6,N6-dimethyl-L-lysine" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0166 ; owl:annotatedTarget "[K:meth_2]" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0166 ; owl:annotatedTarget "dimethyllysine" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0166 ; owl:annotatedTarget "epsilon-dimethyllysine" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0166 ; owl:annotatedTarget "lysine derivative Lys(y)" . [] oboInOwl:hasDbXref "PMID:11125103", "RESID:AA0074" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0167 ; owl:annotatedTarget """Residue modification. OBSOLETE remap to MOD:00083.""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0167 ; owl:annotatedTarget "(S)-2-amino-6-(trimethylammonio)hexanoic acid" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0167 ; owl:annotatedTarget "(S)-5-amino-5-carboxy-N,N,N-trimethylpentanaminium" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0167 ; owl:annotatedTarget "M3L" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0167 ; owl:annotatedTarget "N(zeta)-trimethyllysine" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0020 ; owl:annotatedTarget "tem" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0167 ; owl:annotatedTarget "N6,N6,N6-trimethyl-L-lysine" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0167 ; owl:annotatedTarget "[K:meth_3]" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0167 ; owl:annotatedTarget "epsilon-trimethyllysine" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0167 ; owl:annotatedTarget "trimethyllysine" . [] oboInOwl:hasDbXref "PMID:11125103", "RESID:AA0064" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0168 ; owl:annotatedTarget """Residue modification. OBSOLETE remap to MOD:00073.""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0168 ; owl:annotatedTarget "(S)-2-methylamino-4-(methylsulfanyl)butanoic acid" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0168 ; owl:annotatedTarget "2-methylamino-4-(methylthio)butanoic acid" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0168 ; owl:annotatedTarget "MMT" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0168 ; owl:annotatedTarget "N-methyl-L-methionine" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0168 ; owl:annotatedTarget "N-methylmethionine" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0021 ; owl:annotatedTarget """Two proteins can be localised to cell compartments, in the same experiment, if they are expressed as chimeric proteins fused to distinct proteins fluorescing at different wavelengths (Green Fluorescent Protein and Red Fluorescent Protein for example). Using a confocal microscope the two proteins can be visualized in living cells and it can be determined whether they have the same subcellular location. Fluorescence microscopy of cells expressing a GFP fusion protein can also demonstrate dynamic processes such as its translocation from one subcellular compartment to another. OBSOLETE: use imaging technique (MI:0428) and specific probe as feature of each interacting protein.""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0168 ; owl:annotatedTarget "[M:meth]" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0168 ; owl:annotatedTarget "methylmethionine" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0169 ; owl:annotatedTarget """Residue modification. OBSOLETE remap to MOD:00074.""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0169 ; owl:annotatedTarget "(S)-2-methylamino-3-phenylpropanoic acid" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0169 ; owl:annotatedTarget "FMT" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0169 ; owl:annotatedTarget "N-methyl-L-phenylalanine" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0169 ; owl:annotatedTarget "N-methylphenylalanine" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0169 ; owl:annotatedTarget "[F:meth]" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0169 ; owl:annotatedTarget "methylphenylalanine" . [] oboInOwl:hasDbXref "PMID:11125103" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0170 ; owl:annotatedTarget """Residue modification. OBSOLETE remap to MOD:00696.""" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0021 ; owl:annotatedTarget "coloc fluoresc probe" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0170 ; owl:annotatedTarget "phosphorylated" . [] oboInOwl:hasDbXref "PMID:11125103", "RESID:AA0222" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0171 ; owl:annotatedTarget """Residue modification. OBSOLETE remap to MOD:00227.""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0171 ; owl:annotatedTarget "(S)-2-amino-5-[imino(phosphonoamino)methyl]aminopentanoic acid" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0171 ; owl:annotatedTarget "N5-[imino(phosphonoamino)methyl]-L-ornithine" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0171 ; owl:annotatedTarget "RPO" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0171 ; owl:annotatedTarget "[R:po]" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0171 ; owl:annotatedTarget "alpha-amino-delta-phosphonoguanidinovaleric acid" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0171 ; owl:annotatedTarget "omega-N-phospho-L-arginine" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0171 ; owl:annotatedTarget "phosphoarginine" . [] oboInOwl:hasDbXref "PMID:11125103", "RESID:AA0033" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0172 ; owl:annotatedTarget """Residue modification. OBSOLETE remap to MOD:00042.""" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0022 ; owl:annotatedTarget """The subcellular location of a protein can be demonstrated by treating cells fixed on a microscope slide with an antibody specific for the protein of interest. A secondary antibody conjugated with a reactive enzyme (e.g. horseradish peroxidase) is then added. Following a washing step to remove the unbound secondary ligand, a chromogenic substrate (e.g. 3,3', 5,5' tetramethyl benzidine chromogen [TMB]) is converted to a soluble coloured product by the conjugated enzyme and can then be visualised by standard microscopic techniques. OBSOLETE since combination of Interaction Detection Method and Interaction Type.Consider using the Interaction Detection Method imaging techniques (MI:0428) coupled with Interaction Type colocalisation (MI:0403) and Participant detection immunostaining (MI:0422) instead.""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0172 ; owl:annotatedTarget "(S)-2-aminobutanedioic 4-phosphoric anhydride" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0172 ; owl:annotatedTarget "DPO" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0172 ; owl:annotatedTarget "L-aspartic 4-phosphoric anhydride" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0172 ; owl:annotatedTarget "[D:po]" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0172 ; owl:annotatedTarget "beta-aspartyl phosphate" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0172 ; owl:annotatedTarget "phosphoaspartic acid" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0172 ; owl:annotatedTarget "phosphoaspartic acid" . [] oboInOwl:hasDbXref "PMID:11125103", "RESID:AA0034" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0173 ; owl:annotatedTarget """Residue modification. OBSOLETE remap to MOD:00043.""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0173 ; owl:annotatedTarget "(R)-2-amino-3-(phosphonosulfanyl)propanoic acid" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0173 ; owl:annotatedTarget "CPO" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0022 ; owl:annotatedTarget "Immunofluorescence Staining" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0173 ; owl:annotatedTarget "S-phospho-L-cysteine" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0173 ; owl:annotatedTarget "S-phosphonocysteine" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0173 ; owl:annotatedTarget "S3-phosphocysteine" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0173 ; owl:annotatedTarget "[C:po]" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0173 ; owl:annotatedTarget "cysteine phosphate thioester" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0173 ; owl:annotatedTarget "phosphocysteine" . [] oboInOwl:hasDbXref "PMID:11125103", "RESID:AA0037" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0176 ; owl:annotatedTarget """Residue modification. OBSOLETE remap to MOD:00046.""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0176 ; owl:annotatedTarget "(S)-2-amino-3-(phosphonooxy)propanoic acid" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0176 ; owl:annotatedTarget "2-amino-3-hydroxypropanoic acid 3-phosphate" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0176 ; owl:annotatedTarget "2-amino-3-hydroxypropanoic acid 3-phosphate;O-phosphonoserine;O3-phosphoserine" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0022 ; owl:annotatedTarget "Immunostaining" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0176 ; owl:annotatedTarget "O-phospho-L-serine" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0176 ; owl:annotatedTarget "O-phosphonoserine" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0176 ; owl:annotatedTarget "O3-phosphoserine" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0176 ; owl:annotatedTarget "SPO" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0176 ; owl:annotatedTarget "[S:po]" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0176 ; owl:annotatedTarget "phosphoserine" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0176 ; owl:annotatedTarget "serine phosphate ester" . [] oboInOwl:hasDbXref "PMID:11125103", "RESID:AA0038" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0177 ; owl:annotatedTarget """Residue modification. OBSOLETE remap to MOD:00047.""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0177 ; owl:annotatedTarget "(2S,3R)-2-amino-3-phosphonooxybutanoic acid" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0177 ; owl:annotatedTarget "2-amino-3-hydroxybutanoic acid 3-phosphate" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0022 ; owl:annotatedTarget "coloc immunostaining" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0177 ; owl:annotatedTarget "O-phospho-L-threonine" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0177 ; owl:annotatedTarget "O3-phosphothreonine" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0177 ; owl:annotatedTarget "TPO" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0177 ; owl:annotatedTarget "[T:po]" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0177 ; owl:annotatedTarget "phosphothreonine" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0177 ; owl:annotatedTarget "threonine phosphate ester" . [] oboInOwl:hasDbXref "PMID:11125103", "RESID:AA0039" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0178 ; owl:annotatedTarget """Residue modification. OBSOLETE remap to MOD:00048.""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0178 ; owl:annotatedTarget "(S)-2-amino-3-(4-phosphonooxyphenyl)propanoic acid" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0178 ; owl:annotatedTarget "2-amino-3-(4-hydroxyphenyl)propanoic acid 4'-phosphate" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0178 ; owl:annotatedTarget "O4'-phospho-L-tyrosine" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0002 ; owl:annotatedTarget "participant detection" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0023 ; owl:annotatedTarget """Techniques enabling the identification of the subcellular localisation of a protein or complex. Two different proteins show a similar distribution in the cell are said to co-localise. Obsolete since combination of Interaction Detection Method and Interaction Type. OBSOLETE. Consider using imaging techniques (MI:0428) as interaction detection method coupled with colocalisation (MI:0401) as interaction type and predetermined (MI:0396) as participant detection.""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0178 ; owl:annotatedTarget "O4-phosphotyrosine" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0178 ; owl:annotatedTarget "YPO" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0178 ; owl:annotatedTarget "[Y:po]" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0178 ; owl:annotatedTarget "phosphotyrosine" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0178 ; owl:annotatedTarget "tyrosine phosphate" . [] oboInOwl:hasDbXref "PMID:11125103" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0179 ; owl:annotatedTarget """Residue modification. OBSOLETE remap to MOD:00032.""" . [] oboInOwl:hasDbXref "PMID:11125103", "RESID:AA0022" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0180 ; owl:annotatedTarget """Residue modification. OBSOLETE remap to MOD:00031.""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0180 ; owl:annotatedTarget "3-selenylalanine" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0180 ; owl:annotatedTarget "CSE" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0180 ; owl:annotatedTarget "L-selenocysteine" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0023 ; owl:annotatedTarget "coloc visual technol" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0180 ; owl:annotatedTarget "[C:sel]" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0180 ; owl:annotatedTarget "selenium cysteine" . [] oboInOwl:hasDbXref "PMID:11125103" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0181 ; owl:annotatedTarget """Residue modification. OBSOLETE remap to MOD:00530.""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0181 ; owl:annotatedTarget "L-selenomethionine" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0181 ; owl:annotatedTarget "MSE" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0181 ; owl:annotatedTarget "[M:sel]" . [] oboInOwl:hasDbXref "PMID:11125103", "RESID:AA0185" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0182 ; owl:annotatedTarget """Residue modification. OBSOLETE remap to MOD:01169.""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0182 ; owl:annotatedTarget "(S)-2-amino-3-oxopropanoic acid" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0182 ; owl:annotatedTarget "2-amino-3-oxopropionic acid" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0182 ; owl:annotatedTarget "L-3-oxoalanine" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0024 ; owl:annotatedTarget "Text mining is used to support interactions which have been determined by other methods." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0182 ; owl:annotatedTarget "L-alpha-formylglycine" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0182 ; owl:annotatedTarget "L-amino-malonic acid semialdehyde" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0182 ; owl:annotatedTarget "L-aminomalonaldehydic acid" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0182 ; owl:annotatedTarget "L-serinesemialdehyde [misnomer]" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0182 ; owl:annotatedTarget "SOX" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0182 ; owl:annotatedTarget "[S:oxal]" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0182 ; owl:annotatedTarget "oxoalanine" . [] oboInOwl:hasDbXref "PMID:11125103", "RESID:AA0170" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0184 ; owl:annotatedTarget """Residue modification. OBSOLETE remap to MOD:00179.""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0184 ; owl:annotatedTarget "(S)-2-amino-5-[2-([([2,3-dihydroxypropyl]oxy)(hydroxy)phosphoryl]oxy)ethyl]amino-5-oxopentanoic acid" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0184 ; owl:annotatedTarget "EGE" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0024 ; owl:annotatedTarget "conformational tm" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0184 ; owl:annotatedTarget "L-glutamyl 5-glycerophosphoethanolamine" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0184 ; owl:annotatedTarget "L-glutamyl 5-glycerophosphorylethanolamine" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0184 ; owl:annotatedTarget "L-glutamyl 5-glycerylphosphorylethanolamine" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0184 ; owl:annotatedTarget "[E:gpe]" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0184 ; owl:annotatedTarget "glycerylpo4etohamine" . [] oboInOwl:hasDbXref "PMID:11125103", "RESID:AA0117" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0186 ; owl:annotatedTarget """Residue modification. OBSOLETE remap to MOD:00126.""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0186 ; owl:annotatedTarget "(3aS-(3aalpha,4beta,6aalpha))-N6-(5-(hexahydro-2-oxo-1H-thieno(3,4-d)imidazol-4-yl)-1-oxopentyl)-L-lysine" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0186 ; owl:annotatedTarget "(S)-2-amino-6-[5-((3aS,4S,6aR)-hexahydro-2-oxo-1H-thieno[3,4-d]imidazol-4-yl)-1-oxopentyl]aminohexanoic acid" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0186 ; owl:annotatedTarget "KBT" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0186 ; owl:annotatedTarget "N6-[5-((3aS,4S,6aR)-hexahydro-2-oxo-1H-thieno[3,4-d]imidazol-4-yl)-1-oxopentyl]-L-lysine" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0025 ; owl:annotatedTarget """Approaches designed to separate cell components on the basis of their physicochemical properties. The observation that two or more proteins copurify in one or several conditions is taken as an indication that they form a molecular complex. OBSOLETE since too non-specific. Consider use of cosedimentation (MI:0027) or comigration in non denaturing gel electrophoresis (MI:0404) or affinity chromatography technologies (MI:0004) or molecular sieving (MI:0071) or for unspecific cases biochemical (MI:0401).""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0186 ; owl:annotatedTarget "N6-biotinyl-L-lysine" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0186 ; owl:annotatedTarget "N6-biotinyllysine" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0186 ; owl:annotatedTarget "[K:biotin]" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0186 ; owl:annotatedTarget "biocytin" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0186 ; owl:annotatedTarget "biotinyllysine" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0186 ; owl:annotatedTarget "epsilon-N-biotinyllysine" . [] oboInOwl:hasDbXref "PMID:11125103", "RESID:AA0116" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0187 ; owl:annotatedTarget """Residue modification. OBSOLETE remap to MOD:00125.""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0187 ; owl:annotatedTarget "(S,R)-2-amino-6-(4-amino-2-hydroxybutylamino)hexanoic acid" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0187 ; owl:annotatedTarget "KHY" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0187 ; owl:annotatedTarget "N6-(4-amino-2-hydroxybutyl)-L-lysine" . [] oboInOwl:hasDbXref "PMID:11933068" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0026 ; owl:annotatedTarget "Pairs of multiple alignments of orthologous sequences are used to identify potential interacting partners as proteins that show covariation of their residue identities between different species. Proteins displaying inter-protein correlated mutations during evolution are likely to be interacting proteins due to co-adapted evolution of their protein interacting interfaces." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0187 ; owl:annotatedTarget "[K:hypu]" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0187 ; owl:annotatedTarget "hypusine" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0187 ; owl:annotatedTarget "hypusine" . [] oboInOwl:hasDbXref "PMID:11125103", "RESID:AA0120" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0188 ; owl:annotatedTarget """Residue modification. OBSOLETE remap to MOD:00129.""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0188 ; owl:annotatedTarget "(S)-2-amino-6-[(2E,4E,6E,8E)-3,7-dimethyl-9-(2,6,6-trimethylcyclohex-1-en-1-yl)-2,4,6,8-nonatetraenylidene]aminohexanoic acid" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0188 ; owl:annotatedTarget "KRT" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0188 ; owl:annotatedTarget "N6-retinal-L-lysine" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0188 ; owl:annotatedTarget "N6-retinyl-lysine" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0188 ; owl:annotatedTarget "N6-retinylidene-L-lysine" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0188 ; owl:annotatedTarget "[K:retin]" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0027 ; owl:annotatedTarget "Separation of a mixture of molecules under the influence of a force such as artificial gravity. Molecules sedimenting together are assumed to interact." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0188 ; owl:annotatedTarget "retinallysine" . [] oboInOwl:hasDbXref "PMID:11125103", "RESID:AA0125" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0189 ; owl:annotatedTarget """Residue modification due to a cross-link between a lysine and a glycine from the ubiquitine protein. OBSOLETE remap to MOD:00134.""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0189 ; owl:annotatedTarget "KUB" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0189 ; owl:annotatedTarget "N6-glycyl-L-lysine" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0189 ; owl:annotatedTarget "N6-glycyllysine" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0189 ; owl:annotatedTarget "[K:ub]" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0190 ; owl:annotatedTarget "Connection between molecule." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0191 ; owl:annotatedTarget """Physical association among molecules. OBSOLETE since too non-specific. Consider using physical interaction (MI:0218) instead.""" . [] oboInOwl:hasDbXref "GO:0006473", "PMID:14755292", "RESID:AA0041", "RESID:AA0042", "RESID:AA0043", "RESID:AA0044", "RESID:AA0045", "RESID:AA0046", "RESID:AA0047", "RESID:AA0048", "RESID:AA0049", "RESID:AA0050", "RESID:AA0051", "RESID:AA0052", "RESID:AA0053", "RESID:AA0054", "RESID:AA0055", "RESID:AA0056" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0192 ; owl:annotatedTarget "Reaction, that can affect K,C,A,D,E,Q,G,I,K,M,P,S,T,Y,V residues." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0192 ; owl:annotatedTarget "acetylation" . [] oboInOwl:hasDbXref "PMID:10410796" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0028 ; owl:annotatedTarget "The ultracentrifuge can be used to characterise and/or purify macromolecules in solution according to their mass and hydrodynamic properties. Sedimentation studies provide information about the molecular weight and shape of a molecule. It is also possible to measure the association state of the sample. Both the mass of a molecule and its shape, that influences the friction forces and diffusion that counterbalances gravity, determine the sedimentation speed." . [] oboInOwl:hasDbXref "GO:0001519", "PMID:14755292", "RESID:AA0081", "RESID:AA0082", "RESID:AA0083", "RESID:AA0084", "RESID:AA0085", "RESID:AA0086", "RESID:AA0087", "RESID:AA0088", "RESID:AA0089", "RESID:AA0090", "RESID:AA0091", "RESID:AA0092", "RESID:AA0093", "RESID:AA0094", "RESID:AA0095", "RESID:AA0096", "RESID:AA0097", "RESID:AA0098", "RESID:AA0099", "RESID:AA0100" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0193 ; owl:annotatedTarget "Irreversible reaction that can affect A,R,N,D,C,Q,E,G,H,I,L,K,M,F,P,S,T,W,Y or V residues. It involves the addition of an amide group from a glycine to the target residue." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0193 ; owl:annotatedTarget "amidation" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0194 ; owl:annotatedTarget "Covalent bond breakage in a molecule leading to the formation of smaller molecules." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0194 ; owl:annotatedTarget "cleavage" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0195 ; owl:annotatedTarget "Interaction leading to the formation of covalent bond within an autocatalytic molecule or between partners." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0196 ; owl:annotatedTarget """Physical interaction mediated by covalent bond rearrangement. OBSOLETE use covalent binding (MI:0195) instead.""" . [] oboInOwl:hasDbXref "GO:0006476", "PMID:14755292", "RESID:AA0055", "RESID:AA0056" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0197 ; owl:annotatedTarget "N6-acetyl-L-lysine or S-acetyl-L-cysteine are cleaved and return K or C residues." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0197 ; owl:annotatedTarget "deacetylation" . [] oboInOwl:hasDbXref "PMID:14755292", "RESID:AA0102" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0198 ; owl:annotatedTarget "S-farnesyl-L-cysteined is cleaved and returns a C residue." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0198 ; owl:annotatedTarget "defarnesylation" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0028 ; owl:annotatedTarget "solution sedimentati" . [] oboInOwl:hasDbXref "PMID:14755292", "RESID:AA0211" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0199 ; owl:annotatedTarget "N6-formyl-L-lysine is cleaved and returns a K residue." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0199 ; owl:annotatedTarget "deformylation" . [] oboInOwl:hasDbXref "PMID:14755292", "RESID:AA0104" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0200 ; owl:annotatedTarget "S-geranylgeranyl-L-cysteine is cleaved and returns a C residue." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0200 ; owl:annotatedTarget "degeranylation" . [] oboInOwl:hasDbXref "PMID:14755292", "RESID:AA0078" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0201 ; owl:annotatedTarget "N6-myristoyl-L-lysine is cleaved and returns a K residue." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0201 ; owl:annotatedTarget "demyristoylation" . [] oboInOwl:hasDbXref "PMID:14755292", "RESID:AA0060", "RESID:AA0077", "RESID:AA0106" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0202 ; owl:annotatedTarget "S-palmitoyl-L-cysteine, N6-palmitoyl-L-lysine, O-palmitoyl-L-threonine or O-palmitoyl-L-serine are cleaved and return C,K,T or S residues." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0202 ; owl:annotatedTarget "depalmitoylation" . [] oboInOwl:hasDbXref "GO:0016311", "PMID:14755292", "RESID:AA0033", "RESID:AA0034", "RESID:AA0035", "RESID:AA0036", "RESID:AA0037", "RESID:AA0038", "RESID:AA0039", "RESID:AA0222" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0203 ; owl:annotatedTarget "Phosphoresidues are cleaved and return D,C,H,S,T,Y or R residues." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0203 ; owl:annotatedTarget "dephosphorylation" . [] oboInOwl:hasDbXref "PMID:10410796" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0029 ; owl:annotatedTarget "Sedimentation through a density gradient measures the sedimentation rate of a mixture of proteins through either a glycerol or sucrose gradient. Two interacting proteins will sediment mostly as a complex at concentrations above the binding constant. By varying the concentration of one or both of the complex constituents and taking into account the dilution of the species during sedimentation, one can reasonably accurately estimate the binding constant." . [] oboInOwl:hasDbXref "GO:0016579", "PMID:11583613", "RESID:AA0125" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0204 ; owl:annotatedTarget "Cleavage of the G-K bond and release of ubiquitin or ubiquitin like proteins." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0204 ; owl:annotatedTarget "deubiquitination" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0205 ; owl:annotatedTarget """Dissociation of partners interacting via non-covalent bond. OBSOLETE because considered misleading.""" . [] oboInOwl:hasDbXref "GO:0018347", "PMID:14755292", "RESID:AA0102" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0206 ; owl:annotatedTarget "Reversible reaction that can affect C residue." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0206 ; owl:annotatedTarget "farnesylation" . [] oboInOwl:hasDbXref "GO:0018256", "PMID:14755292", "RESID:AA0057", "RESID:AA0211" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0207 ; owl:annotatedTarget "Reaction that can affect K or G residues. Reside is functionalised with a formyl group." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0207 ; owl:annotatedTarget "formylation" . [] oboInOwl:hasDbXref "PMID:16527956" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0208 ; owl:annotatedTarget """An effect in which two genetic perturbations, when combined, result in a phenotype that does not appear to be merely explained by the superimposition or addition of effects of the original perturbations. ab (not=) E""" . [] oboInOwl:hasDbXref "PMID:17510664", "https://doi.org/10.1017/S0080456800012163" ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0208 ; owl:annotatedTarget "Fisher epistasis" . [] oboInOwl:hasDbXref "GO:0018348", "PMID:14755292", "RESID:AA0104" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0209 ; owl:annotatedTarget "Attachment of one or two 20-carbon lipophilic geranylgeranyl isoprene units from geranylgeranyl diphosphate to one or more cysteine residue(s).Reversible reaction that can affect C residue." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0002 ; owl:annotatedTarget "participant ident" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0029 ; owl:annotatedTarget "density sedimentation" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0209 ; owl:annotatedTarget "geranylgeranylation" . [] oboInOwl:hasDbXref "GO:0018126", "PMID:14755292", "RESID:AA0028", "RESID:AA0029", "RESID:AA0030", "RESID:AA0146", "RESID:AA0215" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0210 ; owl:annotatedTarget "Irreversible introduction of a hydroxyl group that can affect K,P,Y or R residues. Hydroxylation is the first step in the oxidative degeneration of organic compounds." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0210 ; owl:annotatedTarget "hydroxylation" . [] oboInOwl:hasDbXref "GO:0006497", "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0211 ; owl:annotatedTarget "Covalent or non covalent binding of lipid group on a protein residue." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0212 ; owl:annotatedTarget "Cleavage of a lipid group covalently bound to a protein residue." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0212 ; owl:annotatedTarget "lipid cleavage" . [] oboInOwl:hasDbXref "GO:0043414", "PMID:14755292", "RESID:AA0061", "RESID:AA0062", "RESID:AA0063", "RESID:AA0064", "RESID:AA0065", "RESID:AA0066", "RESID:AA0067", "RESID:AA0068", "RESID:AA0069", "RESID:AA0070", "RESID:AA0071", "RESID:AA0072", "RESID:AA0073", "RESID:AA0074", "RESID:AA0075", "RESID:AA0076", "RESID:AA0234", "RESID:AA0272" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0213 ; owl:annotatedTarget "The covalent attachment of a methyl residue to one or more monomeric units in a polypeptide, polynucleotide, polysaccharide, or other biological polymer. Irreversible reaction that can affect A,G,M,F,P,C,R,N,Q,E,H,or K residues." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0213 ; owl:annotatedTarget "methylation" . [] oboInOwl:hasDbXref "GO:0018319", "PMID:14755292", "RESID:AA0059", "RESID:AA0078" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0214 ; owl:annotatedTarget "Irreversible covalent addition of a myristoyl group via an amide bond to the alpha-amino group of an amino acid. Reaction that can affect K or G residues." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0214 ; owl:annotatedTarget "myristoylation" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0030 ; owl:annotatedTarget "Analysis of complexes obtained by input of energy or chemical treatments, or by introducing cysteines followed by oxidation to promote the formation of covalent bonds among molecules in close proximity." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0215 ; owl:annotatedTarget """Interaction mediated by non-covalent, weak forces rearrangement. OBSOLETE use physical interaction (MI:0218) instead.""" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0215 ; owl:annotatedTarget "non covalent inter" . [] oboInOwl:hasDbXref "GO:0018318", "PMID:14755292", "RESID:AA0060", "RESID:AA0077", "RESID:AA0079", "RESID:AA0080", "RESID:AA0106" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0216 ; owl:annotatedTarget "Covalent attachment of palmitic acid to the cysteine residues of membrane proteins. Reversible reaction that can affect C,K,T or S residues." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0216 ; owl:annotatedTarget "palmitoylation" . [] oboInOwl:hasDbXref "GO:0016310", "PMID:14755292", "RESID:AA0033", "RESID:AA0034", "RESID:AA0035", "RESID:AA0036", "RESID:AA0037", "RESID:AA0038", "RESID:AA0039", "RESID:AA0222" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0217 ; owl:annotatedTarget "Reversible reaction that can affect D,C,H,S,T,Y,R residues." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0217 ; owl:annotatedTarget "phosphorylation" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0218 ; owl:annotatedTarget """Interaction among molecules that can be direct or indirect. OBSOLETE: splitted to 'association' MI:0914 and 'physical association' MI:0915. For remapping consider the experimental setting of an interaction. For bulk remapping a possible criteria is to whatever physical interaction that has among its participant a bait should become 'association' MI:0914 the others can become 'physical association' MI:0915. Two hybrid interactions are an expection and can be 'physical association' MI:0915.""" . [] oboInOwl:hasDbXref "PMID:15608217" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0219 ; owl:annotatedTarget """Death phenotype observed on cells carrying combination of two independently silent mutations. OBSOLETE: remap to CV intraction type 'synthetic interaction' MI:0794 and external CV for phenotype description (lethal FBcv:0000351)""" . [] oboInOwl:hasDbXref "GO:0016567", "PMID:11583613", "RESID:AA0125" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0220 ; owl:annotatedTarget "Reversible reaction that create a covalent bond between a C-terminus G of ubiquitin and a K residue of the target." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0220 ; owl:annotatedTarget "ubiquitination" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0030 ; owl:annotatedTarget "crosslink" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0221 ; owl:annotatedTarget "Synthesis rate of a molecule under investigation described in comparison with its naturally occurring expression level in a cell." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0222 ; owl:annotatedTarget "A molecule whose synthesis is under control of its natural gene promoter or estimated to be expressed at a similar rate." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0222 ; owl:annotatedTarget "endogenous" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0222 ; owl:annotatedTarget "endogenous level" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0223 ; owl:annotatedTarget "A molecule is estimated to be expressed at lower levels than in physiological condition." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0223 ; owl:annotatedTarget "under-expressed" . [] oboInOwl:hasDbXref "PMID:11125145", "PMID:11206552" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0225 ; owl:annotatedTarget "The method combines a modified chromatin immunoprecipitation (ChIP) procedure, with DNA microarray analysis. Cells are fixed with formaldehyde, harvested, and disrupted by sonication. The DNA fragments cross-linked to a protein of interest are enriched by immunoprecipitation with a specific antibody. After reversal of the cross-links, the enriched DNA is amplified and labeled with a fluorescent dye (Cy5) by using a ligation-mediatedpolymerase chain reaction (LM-PCR). In parallel a sample of DNA that is not enriched by immunoprecipitation is subjected to LM-PCR in the presence of a different fluorophore (Cy3), and both immunoprecipitation (IP)-enriched and unenriched pools of labeled DNA were hybridized to a single DNA microarray containing a set of intergenic sequences. The ratio of the Cy5 to Cy3 fluorescence intensities measured at each DNA element in the microarray provided a measure of the extent of binding of the transcription factor to the corresponding genomic locus." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0225 ; owl:annotatedTarget "chip-chip" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0226 ; owl:annotatedTarget "Stable complexes and their component proteins can be separated on the basis of their net charge by ion-exchange chromatography. If a protein has a net positive charge at pH 7, it will usually bind to a column of beads containing carboxylate groups, and can then be eluted by increasing the concentration of sodium chloride or another salt in the eluting buffer by competition of sodium ions with positively charged groups on the protein for binding to the column. Protein that have a low density of net positive charge will tend to emerge first, followed by those having a higher charge density. Positively charged complexes or proteins (cationic proteins) can be separated on negatively charged carboxymethyl-cellulose (CM-cellulose) columns. Conversely, negatively charged complexes or proteins (anionic proteins) can be separated by chromatography on positively charged diethylaminoethyl-cellulose (DEAE-cellulose) columns." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0226 ; owl:annotatedTarget "IEC" . [] oboInOwl:hasDbXref "PMID:10679368", "PMID:7708014" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0031 ; owl:annotatedTarget "Cross-linking agents induce the formation of covalent bonds among proteins that are neighbours. The cross-linker may be a bifunctional molecule having two reactive ends linked by a spacer, often containing a disulfide bond. When a reducing agent is added the disulfide bridge is cleaved, the cross-linked pairs are released and can be identified. There are various classes of cross-linkers, the most common are those having photoreactive groups that become reactive fluorophores when activated by UV light thereby resulting in photolabeling the cross-linked moieties." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0226 ; owl:annotatedTarget "ion exchange chrom" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0227 ; owl:annotatedTarget "Reverse phase chromatography operates on the basis of hydrophilicity and lipophilicity. The stationary phase consists of silica based packings with n-alkyl chains covalently bound. For example, C-8 signifies an octyl chain and C-18 an octadecyl ligand in the matrix. The more hydrophobic the matrix on each ligand, the greater is the tendency of the column to retain hydrophobic moieties. Thus hydrophilic compounds elute more quickly than do hydrophobic compounds." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0227 ; owl:annotatedTarget "reverse phase chrom" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0228 ; owl:annotatedTarget "Protein complementation assay performed by dissecting a cytoplasmic protein activity and restoring it through the two hybrid proteins interaction. OBSOLETE remap to MI:0090 protein complementation assay" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0228 ; owl:annotatedTarget "cytoplasmic compl" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0230 ; owl:annotatedTarget "OBSOLETE remap to MI:0090 protein complementation assay." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0230 ; owl:annotatedTarget "membrane compl" . [] oboInOwl:hasDbXref "PMID:12853652" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0231 ; owl:annotatedTarget "The MAPPIT(mammalian protein-protein interaction Trap) is a screening method for protein-protein interaction in mammalian cells, based on the reconstitution of a membrane STAT (signal transducers and activators of transcription) receptor. The bait protein is fused to a STAT recruitment-deficient receptor and the prey protein to a functional STAT recruitment sites. In such a configuration, a given baitprey interaction restores a STAT-dependent responses leading to the expression of a reporter gene. This system, enable to demonstrate not only protein interaction but also modification-independent and tyrosine phosphorylation- dependent interactions." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0231 ; owl:annotatedTarget "mappit" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0232 ; owl:annotatedTarget "Protein complementation assay performed by dissecting a transcription factor activity (DNA binding domain and transcription activation domain) its restoration through the two hybrid proteins interaction that lead to a reporter gene expression." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0031 ; owl:annotatedTarget "Label transfer techniques" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0232 ; owl:annotatedTarget "transcription compl" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0233 ; owl:annotatedTarget "A stable set of interacting protein and DNA that can be copurified and operate as a functional unit." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0234 ; owl:annotatedTarget "Molecule labelled with 131 radio isotope of iodine atoms." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0234 ; owl:annotatedTarget "131I" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0234 ; owl:annotatedTarget "I131" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0235 ; owl:annotatedTarget "Molecule labelled with the radio isotope 14 of carbon atoms." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0235 ; owl:annotatedTarget "14C" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0235 ; owl:annotatedTarget "C14" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0236 ; owl:annotatedTarget "Molecule labelled with the radio isotope 32 of phosphorus atoms." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0236 ; owl:annotatedTarget "32P" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0031 ; owl:annotatedTarget "Photoaffinity labelling" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0236 ; owl:annotatedTarget "P32" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0237 ; owl:annotatedTarget "Molecule labelled with the radio isotope 33 of phosphorus atoms." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0237 ; owl:annotatedTarget "33P" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0237 ; owl:annotatedTarget "P33" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0238 ; owl:annotatedTarget "Molecules labelled with isotope 3 of hydrogen atoms." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0238 ; owl:annotatedTarget "3H" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0238 ; owl:annotatedTarget "H3" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0238 ; owl:annotatedTarget "tritium" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0239 ; owl:annotatedTarget "Biotin, a 244 Dalton vitamin found in tissue and blood, binds with high affinity to avidin and streptavidin protein. Since biotin is a relatively small molecule, it can be conjugated to many proteins or nucleic acids without significantly altering their biological activity. Biotinylation reagents are available for targeting a variety of specific functional groups, including primary amines, sulfhydryls, carboxyls and carbohydrates that lead to nucleotides or amino acid biotinilation." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0240 ; owl:annotatedTarget "The protein under study is expressed as a fusion with a labelling protein, having either fluorescence properties or an enzymatic activity that facilitates its purification, identification, localisation or quantification." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0031 ; owl:annotatedTarget "bifunctional agent crosslink" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0241 ; owl:annotatedTarget "Protein is fused to horseradish peroxidase, and the measure of this enzyme activity can be taken as indicative of presence of protein." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0241 ; owl:annotatedTarget "hrp tag" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0242 ; owl:annotatedTarget "This qualifier is used when the crossreference is imported from the Gene Ontology tag definition_reference." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0242 ; owl:annotatedTarget "go-definition-ref" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0243 ; owl:annotatedTarget "Reference to the master sequence from which this isoform has been derived." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0243 ; owl:annotatedTarget "isoform-parent" . [] oboInOwl:hasDbXref "PMID:21067998" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0244 ; owl:annotatedTarget """Collection of functional complexes within Reactome - a knowledgebase of biological processes. http://www.reactome.org/. OSOLETE - this concept no longer exists within Reactome.""" . [] a owl:Axiom ; rdfs:label "REACT_[0-9]{1,5}\\.[0-9]{1,3}|[0-9]+" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_0244 ; owl:annotatedTarget "id-validation-regexp:" . [] a owl:Axiom ; rdfs:label "http://www.reactome.org/cgi-bin/eventbrowser?ID=${ac}" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_0244 ; owl:annotatedTarget "search-url:" . [] oboInOwl:hasDbXref "PMID:21067998" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0245 ; owl:annotatedTarget """Collection of protein within the Reactome database - a knowledgebase of biological processes. http://www.reactome.org/. OBSOLETE - this concept no longer exists within Reactome.""" . [] oboInOwl:hasDbXref "PMID:10984529" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0032 ; owl:annotatedTarget "The strategy to determine the complete amino acid sequence of a protein by mass spectrometry relies on the generation of a nested set of fragments differing by one amino acid. This reveals the identity of the residue that has been removed at each degradation step by measuring the mass difference of fragments differing of one residue. Peptide fragments can be obtained by protease treatment combined with the fragmentation promoted by collision (or other methods) within a tandem mass spectrometer. This approach can be carried out with LC MS/MS (Liquid Chromatography Tandem Mass Spectrometry), nanoESI MS/MS (nanoElectrospray Ionisation tandem mass spectrometry), or FTMS (Fourier Transform mass spectrometry) instruments." . [] a owl:Axiom ; rdfs:label "REACT_[0-9]{1,4}\\.[0-9]{1,3}|[OPQ][0-9][A-Z0-9]{3}[0-9]|[OPQ][0-9][A-Z0-9]{3}[0-9]-[0-9]+|[A-Z]{3}[0-9]{5}|[OPQ][0-9][A-Z0-9]{3}[0-9]-PRO_[0-9]{10}" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_0245 ; owl:annotatedTarget "id-validation-regexp:" . [] a owl:Axiom ; rdfs:label "http://www.reactome.org/cgi-bin/link?SOURCE=UNIPROT&ID=${ac}" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_0245 ; owl:annotatedTarget "search-url:" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0246 ; owl:annotatedTarget """CABRI cell lines catalogue available at. http://www.cabri.org/""" . [] a owl:Axiom ; rdfs:label "[0-9]+|ACC\\s[A-Z0-9]+|ECACC\\s[A-Z0-9]+|LMBP\\s[A-Z0-9]+|ICLC\\s[A-Z0-9]+|CIP-[0-9]+|DSMZ_MUTZ\\:ACC\\s[0-9]+" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_0246 ; owl:annotatedTarget "id-validation-regexp:" . [] a owl:Axiom ; rdfs:label "http://www.cabri.org/CABRI/srs-bin/wgetz?-e+-page+EntryPage+[$id]" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_0246 ; owl:annotatedTarget "search-url:" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0247 ; owl:annotatedTarget """New EBI Web Taxonomy. http://www.ebi.ac.uk/newt OBSOLETE: Consider remapping to uniprot taxonomy MI:0942""" . [] a owl:Axiom ; rdfs:label "[0-9]+" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_0247 ; owl:annotatedTarget "id-validation-regexp:" . [] a owl:Axiom ; rdfs:label "http://www.ebi.ac.uk/newt/display?search=${ac}" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_0247 ; owl:annotatedTarget "search-url:" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0248 ; owl:annotatedTarget """The RESID Database of Protein Modifications is a comprehensive collection of annotations and structures for protein modifications including amino-terminal, carboxyl-terminal and peptide chain cross-link post-translational modifications. http://www.ebi.ac.uk/RESID/index.html""" . [] a owl:Axiom ; rdfs:label "AA[0-9]{4}" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_0248 ; owl:annotatedTarget "id-validation-regexp:" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0032 ; owl:annotatedTarget "de novo protein sequence" . [] a owl:Axiom ; rdfs:label "http://srs.ebi.ac.uk/cgi-bin/wgetz?[resid-id:${ac}]+-e" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_0248 ; owl:annotatedTarget "search-url:" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0249 ; owl:annotatedTarget """A Database of Human Unidentified Gene-Encoded Large Proteins Analyzed by Kazusa Human cDNA Project. http://www.kazusa.or.jp/huge/""" . [] a owl:Axiom ; rdfs:label "KIAA[0-9]{4}[A-Z]{0,1}" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_0249 ; owl:annotatedTarget "id-validation-regexp:" . [] a owl:Axiom ; rdfs:label "http://www.kazusa.or.jp/huge/gfpage/${ac}" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_0249 ; owl:annotatedTarget "search-url:" . [] oboInOwl:hasDbXref "PMID:14755292", "SO:0000704" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0250 ; owl:annotatedTarget "A genomic region (or regions) that includes all of the sequence elements necessary to encode a functional transcript. A gene may include regulatory regions, transcribed regions and/or other functional sequence regions." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0251 ; owl:annotatedTarget "Reference of a protein object pointing to its genomic or nucleic acid sequence." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0252 ; owl:annotatedTarget "Property of a subsequence that may be involved with or interfere with the binding of a molecule and are supported by experimental evidences." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0253 ; owl:annotatedTarget "One of several nuclides having the same number of protons in their nuclei and hence having the same atomic number, but differing in the number of neutrons and therefore, in the mass number." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0254 ; owl:annotatedTarget "This term refers to methods that aim at interfering with the activity of a specific gene by altering the gene regulatory or coding sequences. This goal can be achieved either by a classical genetic approach (random mutagenesis followed by phenotype characterization and genetic mapping) or by a reverse genetics approach where a gene of interest is modified by directed mutagenesis." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0255 ; owl:annotatedTarget "This term refers to methods designed to interfere with gene expression at post-transcriptional level rather than with the gene itself." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0033 ; owl:annotatedTarget "In this approach, once a molecule is demonstrated to participate in an interaction, several deletion derivatives are produced and tested in the binding assay to identify the minimal fragment (domain) that can still support the interaction." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0255 ; owl:annotatedTarget "expression interfer" . [] oboInOwl:hasDbXref "PMID:12110901", "PMID:12408823" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0256 ; owl:annotatedTarget "RNA interference (RNAi) is a post-transcriptional gene silencing method reproducing a naturally occurring phenomena. RNAi is the process whereby double-stranded RNA (dsRNA) induces the sequence-specific degradation of homologous mRNA. RNAi or dsRNA-induced silencing phenomena are present in evolutionarily diverse organisms, e.g., nematodes, plants, fungi, and trypanosomes. The mechanisms by which RNAi works is initiated by a progressive cleavage of dsRNA into 21 to 23 nucleotide (nt) short interfering RNAs (siRNAs). These native siRNA duplexes are then incorporated into a protein complex called RNA-induced silencing complex (RISC). ATP-dependent unwinding of the siRNA duplex generates an active RISC complex. Guided by the antisense strand of siRNA, the active RISC complex recognizes and cleaves the corresponding mRNA." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0256 ; owl:annotatedTarget "rnai" . [] oboInOwl:hasDbXref "PMID:1340158" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0257 ; owl:annotatedTarget "This approach is based on the observation that expression of RNA that is complementary to a specific mRNA can decrease the synthesis of its gene product either by increasing the degradation of the targeted mRNA or by interfering with its translation." . [] oboInOwl:hasDbXref "PMID:10189716" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0258 ; owl:annotatedTarget """Intracellular or extracellular expression of antibodies is used to target specific gene products in order to inactivate them. Most of the times the antibody scaffold need s to reengineered for efficient expression and solubility in the cytoplasm. OBSOLETE as such method can be described using the biological role inhibitor (MI:0586).""" . [] oboInOwl:hasDbXref "PMID:11731788", "PMID:8606778" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0259 ; owl:annotatedTarget """This approach is based on the expression of peptides that bind to specific target proteins thereby interfering with their activity. In a standard approach the interfering peptide is expressed by genetic fusion to a stable protein scaffold. Interfering peptides can also be introduced into cells by fusing them to proteins or peptides (homeodomains, Tat protein.) having the property of penetrating the cell membrane. The peptide-carrier fusion protein is either synthesized chemically or produced in vivo, normally in bacteria. When the purified fusion protein is added to a cell culture, it penetrates the cell membrane thereby permitting the fused peptide to interfere with its target protein. OBSOLETE as such method can be described using the biological role inhibitor (MI:0586).""" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0259 ; owl:annotatedTarget "perturbagens pep" . [] oboInOwl:hasDbXref "PMID:10542155", "PMID:10780927" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0260 ; owl:annotatedTarget """Protein activity is inhibited by small inorganic molecules (drugs) that specifically bind to their targets. Recently this classical pharmacological approach is sometime referred to as 'chemical genetics'. OBSOLETE as such method can be described using the biological role inhibitor (MI:0586).""" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0260 ; owl:annotatedTarget "inhibitor small mol" . [] oboInOwl:hasDbXref "PMID:15608217" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0261 ; owl:annotatedTarget """A supressed gene mutation cause of an altered phenotype that is reverted to wild type phenotype when cell also carry a suppressor gene with a specific mutation or altered expression level. OBSOLETE: remap to CV intraction type 'suppressive interaction' MI:0793.""" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0003 ; owl:annotatedTarget "Method to determine the features of the proteins involved in the interaction." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0034 ; owl:annotatedTarget "All the methods that permit the physical linking of a protein/peptide to its coding sequence. As a consequence affinity purification of the displayed peptide results in the genetic enrichment of its coding sequence. By these technologies genes encoding a peptide with desired binding properties can be selected over an excess of up to 1012 unrelated molecules." . [] oboInOwl:hasDbXref "PMID:15608217" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0262 ; owl:annotatedTarget """A given (suppressed) mutation phenotype is reverted by a supressor gene mutation. OBSOLETE: remap to CV intraction type 'suppressive interaction' MI:0793 and genetic experimental form 'mutated gene' MI:0804. """ . [] oboInOwl:hasDbXref "PMID:15608217" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0263 ; owl:annotatedTarget """Knocked out gene is the suppressor of a phenotype. OBSOLETE: remap to CV intraction type 'suppressive interaction' MI:0793 and genetic experimental form 'knock out' MI:0788. """ . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0263 ; owl:annotatedTarget "suppress knockout" . [] oboInOwl:hasDbXref "PMID:15608217" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0264 ; owl:annotatedTarget """A mutation is the partial suppressor of a mutant phenotype. OBSOLETE: remap to CV intraction type 'suppressive interaction' MI:0793 and genetic experimental form 'knock down' MI:0789. """ . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0264 ; owl:annotatedTarget "suppression partial" . [] oboInOwl:hasDbXref "PMID:15608217" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0265 ; owl:annotatedTarget """An altered expression is the suppressor of a phenotype. OBSOLETE: remap to CV intraction type 'suppressive interaction' MI:0793 and genetic experimental form 'expression level alteration' MI:0803. """ . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0265 ; owl:annotatedTarget "suppress expression" . [] oboInOwl:hasDbXref "PMID:15608217" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0266 ; owl:annotatedTarget """Overexpression is the suppressor of a phenotype. OBSOLETE: remap to CV intraction type 'suppressive interaction' MI:0793 and genetic experimental form 'over expressed' MI:0506. """ . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0266 ; owl:annotatedTarget "suppress overexpress" . [] oboInOwl:hasDbXref "PMID:15608217" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0267 ; owl:annotatedTarget """Level of over/underexpression scales the 'extend' of a phenotype. OBSOLETE: remap to CV intraction type 'suppressive interaction' MI:0793 and genetic experimental form 'expression level alteration' MI:0803. """ . [] oboInOwl:hasDbXref "PMID:11478868", "PMID:9631301" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0035 ; owl:annotatedTarget "Predicts the structure of a molecular complex from the unbound structures of its components. The initial approach in the majority of docking procedures is based largely on the 'rigid-body' assumption, whereby the proteins are treated as solid objects. Initial scoring of a complex is based on geometric fit or surface complementarity. This generally requires some knowledge of the binding site to limit the number of solutions." . [] oboInOwl:hasDbXref "PMID:15608217" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0268 ; owl:annotatedTarget """Underexpression is the suppressor of a phenotype. OBSOLETE: remap to CV intraction type 'suppressive interaction' MI:0793 and genetic experimental form 'under expressed' MI:0223. """ . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0268 ; owl:annotatedTarget "suppress underexpres" . [] oboInOwl:hasDbXref "PMID:15608217" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0269 ; owl:annotatedTarget """Two silent mutations show an altered phenotype when they co-occur on the same cell. OBSOLETE: remap to CV intraction type 'synthetic interaction' MI:0794.""" . [] oboInOwl:hasDbXref "PMID:15608217" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0270 ; owl:annotatedTarget """Two silent mutations show a conditional synthetic lethal phenotype when they co-occur on the same cell. OBSOLETE: remap to CV intraction type 'synthetic interaction' MI:0794 and external CV for phenotype description (lethal FBcv:0000351)""" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0270 ; owl:annotatedTarget "cond syntetic lethal" . [] oboInOwl:hasDbXref "PMID:15608217" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0271 ; owl:annotatedTarget """Two silent mutations show a temperature sensitive lethal phenotype when they co-occur on the same cell. OBSOLETE: remap to CV intraction type 'synthetic interaction' MI:0794 and external CV for phenotype description (FBcv:0000310 'temperature conditional')""" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0271 ; owl:annotatedTarget "temprtr synt lethal" . [] oboInOwl:hasDbXref "PMID:15608217" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0273 ; owl:annotatedTarget """Two silent mutations show altered growth effect when they co-occur on the same cell. OBSOLETE: remap to CV intraction type 'synthetic interaction' MI:0794 and external CV for phenotype description ( FBcv:0000427 'cell growth defective')""" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0273 ; owl:annotatedTarget "synt growth effect" . [] oboInOwl:hasDbXref "PMID:15608217" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0274 ; owl:annotatedTarget """Two silent mutations show growth defect when they co-occur on the same cell. OBSOLETE: remap to CV intraction type 'synthetic interaction' MI:0794 and external CV for phenotype description ( FBcv:0000427 'cell growth defective')""" . [] oboInOwl:hasDbXref "PMID:10573422" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0036 ; owl:annotatedTarget "The rosetta stone, or domain fusion procedure, is based on the assumption that proteins whose homologues in other organisms happen to be fused into a single protein chain are likely to interact or to be functionally related." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0274 ; owl:annotatedTarget "synt growth defect" . [] oboInOwl:hasDbXref "PMID:15608217" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0275 ; owl:annotatedTarget """Two silent mutations show growth increase when they co-occur on the same cell. OBSOLETE: remap to CV intraction type 'synthetic interaction' MI:0794 and external CV for phenotype description ( FBcv:0000427 'cell growth defective')""" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0275 ; owl:annotatedTarget "synt growth increase" . [] oboInOwl:hasDbXref "PMID:14665681" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0276 ; owl:annotatedTarget "Blue native PAGE (BN-PAGE) permits a high-resolution separation of multi-protein complexes under native conditions. Blue native (BN)-PAGE is a charge shift method, in which the electrophoretic mobility of a complex is determined by the negative charge of the bound Coomassie dye and the size and shape of the complex. Coomassie does not act as a detergent and preserves the structure of complexes. Importantly, the resolution of BN-PAGE is much higher than that of other methods such as gel filtration or sucrose-gradient ultracentrifugation. Combined with other pre-purifications or dialysis steps this method permits the analysis of multi-protein complexes of whole cellular lysates by BN-PAGE." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0276 ; owl:annotatedTarget "bn-page" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0300 ; owl:annotatedTarget "Descriptor of type of nomenclature used to describe interactor." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0300 ; owl:annotatedTarget "CvAliasType" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0301 ; owl:annotatedTarget "Gene name." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0301 ; owl:annotatedTarget "gene" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0302 ; owl:annotatedTarget "Gene name synonym." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0036 ; owl:annotatedTarget "Rosetta Stone" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0303 ; owl:annotatedTarget "Synonym as used in Gene Ontology." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0303 ; owl:annotatedTarget "go synonym" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0304 ; owl:annotatedTarget "Isoform synonym." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0305 ; owl:annotatedTarget "A name used to represent an ORF in a completely sequenced genome or chromosome. It is generally based on a prefix representing the organism and a number which usually represents the sequential ordering of genes on the chromosome. Depending on the genome sequencing center, numbers are attributed only to protein-coding genes, or also to pseudogenes, or also to tRNAs and other features." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0305 ; owl:annotatedTarget "CDS number" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0305 ; owl:annotatedTarget "ONL" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0305 ; owl:annotatedTarget "ORF number" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0305 ; owl:annotatedTarget "Ordered locus name" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0305 ; owl:annotatedTarget "locus name" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0305 ; owl:annotatedTarget "systematic gene number" . [] oboInOwl:hasDbXref "PMID:11473021" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0037 ; owl:annotatedTarget "This approach uses a protein interaction network of a given organism to infer interaction in another organism using information about the interacting region. The regions or domains involved in interactions are clustered if they share sequence similarity and have common interacting partners. The resulting domain profiles are then used to screen the proteome of another organism and domain-domain interactions are inferred. Ultimately, an inferred protein interaction map is built in this second organism." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0306 ; owl:annotatedTarget "A name temporarily attributed by a sequencing project to an open reading frame. This name is generally based on a cosmid numbering system." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0306 ; owl:annotatedTarget "orf name" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0307 ; owl:annotatedTarget "Method by which molecule is delivered or engineered into a cell." . [] oboInOwl:hasDbXref "PMID:6329708" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0308 ; owl:annotatedTarget "Method for temporarily permeabilising cell membranes so as to facilitate the entry of large or hydrophilic molecules (as in transfection). A brief (ca 1 msec) electric pulse is given with potential gradients of about 700V/cm." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0309 ; owl:annotatedTarget """A cassette coding for a protein tag is inserted by homologous recombination onto the genomic copy of an open reading frame. The advantage of this delivery method is that the resulting engineered protein is expressed under its natural promoter control. OBSOLETE redundant term. Map to feature type : tag (MI:0507).""" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0309 ; owl:annotatedTarget "genetic tag insertion" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0310 ; owl:annotatedTarget "Molecule introduced into a cell via an external organism, usually a virus or bacteria." . [] oboInOwl:hasDbXref "PMID:3016916" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0311 ; owl:annotatedTarget "The insertion of a substance into a cell through a microneedle. To extrude the substances through the very fine needle tip, either hydrostatic pressure (pressure injection) or electric currents (ionophoresis) is employed." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0311 ; owl:annotatedTarget "micro-injection" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0312 ; owl:annotatedTarget "Introducing DNA into eukaryotic cells, such as animal cells, is called transfection. Transfection typically involves opening transient \"holes\" or gates in cells to allow the entry of extracellular molecules, typically supercoiled plasmid DNA, but also siRNA, among others. Transfection differs from transformation since the DNA is not generally incorporated into the cell's genome, it is only transiently expressed." . [] oboInOwl:hasDbXref "PMID:9013660" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0038 ; owl:annotatedTarget "In dynamic light scattering, particle diffusion in solution gives rise to fluctuations in the intensity of the scattered light on the microsecond scale. The hydrodynamic radius of the particles can be easily calculated." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0312 ; owl:annotatedTarget "nucl transfection" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0313 ; owl:annotatedTarget "Molecular species involved in the interaction." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0313 ; owl:annotatedTarget "participant type" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0314 ; owl:annotatedTarget "Set of interacting molecules that can be copurified. This term and its children should be use only at PARTICIPANT level." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0315 ; owl:annotatedTarget "A stable set of interacting proteins that can be copurified and operate as a functional unit." . [] oboInOwl:hasDbXref "GO:0030529", "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0316 ; owl:annotatedTarget "A macromolecular complex containing both protein and RNA molecules." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0316 ; owl:annotatedTarget "protein rna complex" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0316 ; owl:annotatedTarget "ribonucleoprot compl" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0317 ; owl:annotatedTarget "Previously described interaction now being used as an interactor to describe hierarchical build-up of complexes." . [] oboInOwl:hasDbXref "PMID:14755292", "SO:0000348" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0318 ; owl:annotatedTarget "Linear polymers of nucleotides, linked by 3',5' phosphodiester linkages." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0038 ; owl:annotatedTarget "dls" . [] oboInOwl:hasDbXref "PMID:14755292", "SO:0000352" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0319 ; owl:annotatedTarget "Polymer formed by the deoxyribose sugar group, and the nucleotides bases adenine, guanine, thymine and cytosine." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0319 ; owl:annotatedTarget "DNA" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0319 ; owl:annotatedTarget "deoxyribonucleic acid" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0319 ; owl:annotatedTarget "dna" . [] oboInOwl:hasDbXref "PMID:14755292", "SO:0000356" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0320 ; owl:annotatedTarget "Polymer formed by ribose sugar group, and the bases of the nucleotides adenine, guanine, uracil and cytosine." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0320 ; owl:annotatedTarget "RNA" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0320 ; owl:annotatedTarget "rna" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0321 ; owl:annotatedTarget "Species of RNA that catalyses cleavage or trans-esterification of the phosphodiester link." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0321 ; owl:annotatedTarget "catalytic RNA" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0321 ; owl:annotatedTarget "catalytic ribonucleic acid" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0039 ; owl:annotatedTarget "In this procedure the N-terminus amino acid is cleaved from a polypeptide and identified by high-pressure liquid chromatography. The cycle is repeated on the ever-shortening polypeptide until all the residues are identified. On average only 20-30 consecutive cycles can be performed and lead to amino acid identification. Longer polypeptides or full length proteins must be cleaved by specific protease before Edman degradation and their sequences built by fragment overlapping." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0321 ; owl:annotatedTarget "crna" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0322 ; owl:annotatedTarget "Small RNA molecules that hybridize to specific mRNAs and direct their RNA editing." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0322 ; owl:annotatedTarget "grna" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0322 ; owl:annotatedTarget "guide RNA" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0323 ; owl:annotatedTarget "A heterogeneous mixture of RNA molecules with a rapid turnover rate that occurs in cell nuclei during protein synthesis; it is the form of RNA synthesized in eukaryotes by RNA polymerase II, which is translated into protein." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0323 ; owl:annotatedTarget "heterogeneous nuclear RNA" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0323 ; owl:annotatedTarget "heterogeneous nuclear ribonucleic acid" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0323 ; owl:annotatedTarget "hnrna" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0324 ; owl:annotatedTarget "Single-stranded RNA molecule that specifies the amino acid sequence of one or more polypeptide chains." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0324 ; owl:annotatedTarget "mRNA" . [] oboInOwl:hasDbXref "PMID:11785754" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0040 ; owl:annotatedTarget "Electron microscopy methods provide insights into the structure of biological macromolecules and their supramolecular assemblies. Resolution is on average around 10 Angstroms but can reach the atomic level when the samples analysed are 2D crystals. Different types of samples can be analysed by electron microscopy: crystals, single particles like viruses, macromolecular complexes or entire cells and tissue sections. Samples can be chemically fixed or vitrified by rapid freezing in liquid ethane, and then transferred into the electron microscope. Data collection consists of the recording of electron diffraction data (2D crystals) and images. Depending on the type of sample, different approaches are used to analyse and merge images and electron diffraction data." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0324 ; owl:annotatedTarget "mrna" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0325 ; owl:annotatedTarget "The low molecular weight RNAs that specifically bind amino acids by aminoacetylation to form aminoacyl tRNA and which possess a special nucleotide triplet, the anticodon." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0325 ; owl:annotatedTarget "tRNA" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0325 ; owl:annotatedTarget "transfer RNA" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0325 ; owl:annotatedTarget "transfer ribonucleic acid" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0325 ; owl:annotatedTarget "trna" . [] oboInOwl:hasDbXref "PMID:14755292", "SO:0000358" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0326 ; owl:annotatedTarget "A linear polymer of amino acids joined by peptide bonds in a specific sequence." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0327 ; owl:annotatedTarget "Chains of amino acids joined by peptide bonds. Distinction between peptides, oligopeptides and polypeptides is arbitrarily by length; a polypeptide is perhaps more than 15 residues." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0327 ; owl:annotatedTarget "oligopeptide" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0327 ; owl:annotatedTarget "polypeptide" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0040 ; owl:annotatedTarget "Electron cryomicroscopy" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0328 ; owl:annotatedTarget "Molecule not part of or directly encoded by the genome, encompasses any constitutionally or isotopically distinct atom, molecule, ion, ion pair, radical, radical ion, complex, conformer, etc., identifiable as a separately distinguishable entity." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0329 ; owl:annotatedTarget "Any type of molecule, including complexes, that may be observed but not identified. This term should be use only at PARTICIPANT level." . [] oboInOwl:hasDbXref "PMID:14755272" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0330 ; owl:annotatedTarget "Defines whether molecule is endogenously expressed or has in any way been altered, in sequence or expression level, from its native state. For a complete description of the experimental molecule form use the orthogonal CVs expression level, delivery method, and sample process." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0331 ; owl:annotatedTarget "Molecule has been added into system from an external source or altered within the cell." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0332 ; owl:annotatedTarget "Unaltered endogenous molecule in its naturally occurring state." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0332 ; owl:annotatedTarget "endogenous" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0333 ; owl:annotatedTarget "Describes sequence positions resolution of a given participant feature. In PSI schema this CV is associated with the start and end position of a feature range." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0333 ; owl:annotatedTarget "CvFuzzyType" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0333 ; owl:annotatedTarget "endStatus" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0333 ; owl:annotatedTarget "startStatus" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0003 ; owl:annotatedTarget "feature detection" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0040 ; owl:annotatedTarget "Electron crystallography" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0334 ; owl:annotatedTarget "Term describing the last amino acid of a peptide chain." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0334 ; owl:annotatedTarget "c-term" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0334 ; owl:annotatedTarget "c-terminal" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0334 ; owl:annotatedTarget "c-terminus" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0334 ; owl:annotatedTarget "carboxy-terminus" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0335 ; owl:annotatedTarget "Position within the sequence clearly defined." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0335 ; owl:annotatedTarget "certain" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0336 ; owl:annotatedTarget "Partially determined sequence position known to be in a location higher than a given position." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0337 ; owl:annotatedTarget "Partially determined sequence position known to be in a position lower than a given position." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0338 ; owl:annotatedTarget "Describes a sequence position known to be in a certain range, where the exact position is unclear." . [] oboInOwl:hasDbXref "PMID:11817959", "PMID:11988476", "PMID:12186859" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0041 ; owl:annotatedTarget "A combination of NMR and EPR. The lines in the EPR spectrum that are caused by coupling of an unpaired electron nearby nuclei change in intensity when these nuclei are excited at their NMR frequency." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0339 ; owl:annotatedTarget "Term describing a completely unknown or unspecified sequence position." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0339 ; owl:annotatedTarget "undetermined" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0340 ; owl:annotatedTarget "Term describing the first amino acid of a peptide chain." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0340 ; owl:annotatedTarget "amino-terminus" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0340 ; owl:annotatedTarget "n-term" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0340 ; owl:annotatedTarget "n-terminal " . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0340 ; owl:annotatedTarget "n-terminus" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0341 ; owl:annotatedTarget "Mixture of protein forms where N-terminus has been progressively truncated." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0342 ; owl:annotatedTarget "Indicates the sample context in which each interacting molecule is presented to its partner." . [] oboInOwl:hasDbXref "PMID:6110205" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0343 ; owl:annotatedTarget "Mixed population of cDNAs (complementaryDNA) made from mRNA from a defined source, usually a specific cell type. This term should be associated only to nucleic acid interactors not to their proteins product. For instance in 2h screening use living cells (MI:0349) as sample process." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0041 ; owl:annotatedTarget "ENDOR" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0344 ; owl:annotatedTarget "Cell has been physically or chemically broken open and molecule present in resulting mixture of cellular components." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0345 ; owl:annotatedTarget "Name assigned to a molecule by the authors within a paper that may differ from the reference database." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0346 ; owl:annotatedTarget "Set of terms to describe the participant experimental treatment and status. This term groups a number of orthologous short controlled vocabularies delivery method, expression level, molecular source, and sample process. Each participant can then be annotated with a maximum of 4 terms selected from each short list." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0346 ; owl:annotatedTarget "experimental prep" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0348 ; owl:annotatedTarget "Cells has been fixed by treatment with organic solvent, staining and inclusion in a resin for microscopic analysis." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0349 ; owl:annotatedTarget "Molecule is observed within in a living cell." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0350 ; owl:annotatedTarget "Molecule has undergone one or more purification steps to isolate it from the cellular environment." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0351 ; owl:annotatedTarget "The author states a molecule is completely pure, i.e. no other molecular species are present." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0351 ; owl:annotatedTarget "pure" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0352 ; owl:annotatedTarget "The author states a molecule is only partially purified, i.e. other molecular species also known to be present." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0041 ; owl:annotatedTarget "endor" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0353 ; owl:annotatedTarget "Qualifier to describe the type of information a cross-reference is pointing to." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0353 ; owl:annotatedTarget "CvXrefQualifier" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0353 ; owl:annotatedTarget "refType" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0353 ; owl:annotatedTarget "xref type" . [] oboInOwl:hasDbXref "PMID:14681407" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0354 ; owl:annotatedTarget "Cross reference pointing to a Gene Ontology -'cellular component' term." . [] a owl:Axiom ; rdfs:label "https://www.ebi.ac.uk/QuickGO/term/${ac}" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_0354 ; owl:annotatedTarget "search-url:" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0354 ; owl:annotatedTarget "component" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0354 ; owl:annotatedTarget "go component term" . [] oboInOwl:hasDbXref "PMID:14681407" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0355 ; owl:annotatedTarget "Cross reference pointing to a Gene Ontology -'molecular function' term." . [] a owl:Axiom ; rdfs:label "https://www.ebi.ac.uk/QuickGO/term/${ac}" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_0355 ; owl:annotatedTarget "search-url:" . [] oboInOwl:hasDbXref "PMID:11817959" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0042 ; owl:annotatedTarget "EPR (also called ESR, Electron Spin Resonance) spectroscopy is analogous to NMR, but is based on the excitation of unpaired electrons instead of nuclei. Unpaired (single) electrons are only found in radicals and some metal ions (paramagnetic species); the EPR spectrum provides information about the environment and mobility of the paramagnetic species. The magnetic interaction of two paramagnetic centres in a protein can be used to calculate the distance between them; this allows studies of the movements and interactions of protein segments. In proteins without any intrinsic unpaired electrons it is possible to attach a radical probe (spin label). Stable nitroxide radicals can be bound to amino acid residues, in analogy with fluorescent probes. In combination with site directed mutagenesis this method is used in particular to study structure and assembly of membrane proteins, by measuring with EPR whether an amino acid is in a polar or non polar environment." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0355 ; owl:annotatedTarget "function" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0355 ; owl:annotatedTarget "go function term" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0356 ; owl:annotatedTarget "Reference to the corresponding object in another database. Correspondence may be complete or partial." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0356 ; owl:annotatedTarget "identity" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0357 ; owl:annotatedTarget "Reference to a related paper which more fully describes either the experimental method or one or more of the interactors used within the experiment." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0358 ; owl:annotatedTarget "Used to indicate the PMID from which the experimental data is extracted." . [] oboInOwl:hasDbXref "PMID:14681407" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0359 ; owl:annotatedTarget "Cross reference pointing to a Gene Ontology -'cellular process' term." . [] a owl:Axiom ; rdfs:label "https://www.ebi.ac.uk/QuickGO/term/${ac}" ; owl:annotatedProperty oboInOwl:hasDbXref ; owl:annotatedSource obo:MI_0359 ; owl:annotatedTarget "search-url:" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0359 ; owl:annotatedTarget "go process term" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0359 ; owl:annotatedTarget "process" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0042 ; owl:annotatedTarget "EPR" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0360 ; owl:annotatedTarget "Reference to the corresponding object in another database (like identity xref qualifier) but the identifier used in the external database is a secondary identifier or former accession number." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0360 ; owl:annotatedTarget "secondary-ac" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0361 ; owl:annotatedTarget "Related object within the same database or pointing to an external database." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0361 ; owl:annotatedTarget "see-also" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0362 ; owl:annotatedTarget "Evidence based on human assumption, either when the complete experimental support is not available or when the results are extended by homology to closely related orthologues sequences." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0362 ; owl:annotatedTarget "modeled" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0362 ; owl:annotatedTarget "modelled" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0363 ; owl:annotatedTarget "Evidence based on the author of a paper assumption, either when the complete experimental support is not available or when the results are extended by homology to closely related orthologues sequences." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0363 ; owl:annotatedTarget "modeled by author" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0363 ; owl:annotatedTarget "modelled by author" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0042 ; owl:annotatedTarget "ESR" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0364 ; owl:annotatedTarget "Evidence based on a curator assumption, either when the complete experimental support is not available or when the results are extended by homology to closely related orthologues sequences." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0364 ; owl:annotatedTarget "modeled by curator" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0364 ; owl:annotatedTarget "modelled by curator" . [] oboInOwl:hasDbXref "PMID:10935637" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0365 ; owl:annotatedTarget "Molecule under study is fused to an enzyme, for example alkaline phosphatase, and measure of enzyme activity can be taken as indicative of presence of protein." . [] oboInOwl:hasDbXref "PMID:10935637" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0366 ; owl:annotatedTarget "Protein is fused to alkaline phosphatase, and the measure of this enzyme activity can be taken as indicative of presence of protein." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0366 ; owl:annotatedTarget "alk phosphatase tag" . [] oboInOwl:hasDbXref "PMID:7491768" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0367 ; owl:annotatedTarget "The green fluorescent protein of organisms such as the bioluminescent jellyfish Aequorea victoria can be fused to individual proteins which then acquire fluorescence excitation and emission spectra virtually identical to those of the native." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0367 ; owl:annotatedTarget "GFP" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0367 ; owl:annotatedTarget "gfp tag" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0367 ; owl:annotatedTarget "green fluorescent protein" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0042 ; owl:annotatedTarget "epr" . [] oboInOwl:hasDbXref "PMID:10929120" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0368 ; owl:annotatedTarget "Yellow fluorescent protein from species such as Vibrio fischeri can be fused to individual proteins which then acquire fluorescence excitation and emission spectra virtually identical to those of the native." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0368 ; owl:annotatedTarget "YFP" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0368 ; owl:annotatedTarget "yellow fluorescent protein" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0368 ; owl:annotatedTarget "yfp tag" . [] oboInOwl:hasDbXref "PMID:12446730" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0369 ; owl:annotatedTarget "The method is based on the repression of a reporter gene activity by two LexA DNA binding domains with different binding specificities. LexA is a transcription factor with an N-terminal DNA binding/activation domain (DBAct) and a C-terminal dimerization domain. LexA dimerization is required to repress transcription efficiently. The discovery of LexA DNA binding domains that bind to different DNA sequence enabled the development of this system." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0369 ; owl:annotatedTarget "gallex" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0369 ; owl:annotatedTarget "gallex" . [] oboInOwl:hasDbXref "PMID:9927659" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0370 ; owl:annotatedTarget "This assay allow identification of interactions in the inner membrane of E. coli. by using a chimeric construct ToxR-TM-MBP composed of the N-terminal DNA binding/transcriptional activation domain of ToxR (a dimerization dependant transcription factor) fused to a transmembrane domain of interest (TM) and a monomeric periplasmic anchor (the maltose binding protein). Association of the two TM results in the ToxR-mediated activation of a reporter gene such as CAT (chloroamphenicol acetyltransferase activity). The level of CAT expression indicates the strength of TM association. CAT expression can then be tested and quantify by measuring CAM resistance with disk diffusion assay or CAT activity assays on cell-free extracts." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0370 ; owl:annotatedTarget "toxcat" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0370 ; owl:annotatedTarget "toxcat" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0043 ; owl:annotatedTarget "A form of spectroscopy in which the absorption of microwave by a sample in a strong magnetic field is used to study atoms or molecules with unpaired electrons." . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0371 ; owl:annotatedTarget "Molecule labelled with 35 radio isotope of sulfur. Proteins are often metabolically labelled, usually be growth in 35S labelled culture medium." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0371 ; owl:annotatedTarget "35S" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0371 ; owl:annotatedTarget "S35" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0371 ; owl:annotatedTarget "s35 radiolabelled" . [] oboInOwl:hasDbXref "PMID:14755292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0372 ; owl:annotatedTarget "Cell lysates are partially fractionated to isolate a specific subcellular fraction." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0372 ; owl:annotatedTarget "subcellular prep" . [] oboInOwl:hasDbXref "PMID:14577292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0373 ; owl:annotatedTarget "Dye coupled to a molecule allowing its identification isolation and monitoring." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0373 ; owl:annotatedTarget "dye labelled" . [] oboInOwl:hasDbXref "PMID:14577292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0374 ; owl:annotatedTarget "The organic polymethine cyanine dyes which, depending on structure, cover the spectrum from IR to UV.s. Their emission range is such that background fluorescence is often reduced. In addition these molecules can be linked directly to specific locations in synthetically produced nucleic acids." . [] oboInOwl:hasDbXref "PMID:14577292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0375 ; owl:annotatedTarget "The organic cyanine Cy3 emits maximally at 570 nm." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0045 ; owl:annotatedTarget "experimental interac" . [] oboInOwl:hasDbXref "PMID:14577292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0376 ; owl:annotatedTarget "The organic cyanine Cy5 emits maximally at 670 nm." . [] oboInOwl:hasDbXref "PMID:14577292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0377 ; owl:annotatedTarget "Fluorescein isothiocyanate is a yellow-green coloured low molecular weight dye which couples to proteins via reaction with primary amine groups at high pH. FITC is excitable at 488nm, close to its absorption maximum at 494nm, and produces maximum fluorescence emission around 520nm." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0377 ; owl:annotatedTarget "FITC labelled" . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0377 ; owl:annotatedTarget "fitc labelled" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0377 ; owl:annotatedTarget "fluorescein isothiocyanate labbeled" . [] oboInOwl:hasDbXref "PMID:14577292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0378 ; owl:annotatedTarget "Molecule can be labelled including rare isotopes among its constituent atoms that can be used to identify, localize or quantify the full molecule." . [] oboInOwl:hasSynonymType mi:PSI-MI-short ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0378 ; owl:annotatedTarget "rare isotope label" . [] oboInOwl:hasDbXref "PMID:14577292" ; a owl:Axiom ; owl:annotatedProperty obo:IAO_0000115 ; owl:annotatedSource obo:MI_0379 ; owl:annotatedTarget "Molecules labelled with isotope 13 of carbon atoms." . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0379 ; owl:annotatedTarget "13C" . [] oboInOwl:hasSynonymType mi:PSI-MI-alternate ; a owl:Axiom ; owl:annotatedProperty oboInOwl:hasExactSynonym ; owl:annotatedSource obo:MI_0379 ; owl:annotatedTarget "C13" .